PRGDB00077246 (Stu.11662)

From PRG Wiki
Jump to: navigation, search
Stu.11662
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39819895 (CK262917)
Gene Class Mlo-like
Domain Type MLO
Gene Species Solanum tuberosum

Comment?

EST708995 potato abiotic stress cDNA library Solanum tuberosum cDNA clone POABJ20 5' end, mRNA sequence

DNA Sequence

AAATGCAGAATGCTTTTCAGTTGGCCTTCTTTGCTTGGACTTGGTATGAATTTGGGTTGAAATCTTGTTACCATGACCATACAGAGGATATTGTCATCAGAATAACTATGGGGGTTCTCATTCAGATTCTGTGCAGTTATGTCACTCTTCCTCTTTATGCCCTTGTAACACAGATGGGTTCAAACATGAAATCAACCATTTTCAATGAAAGAGTAGCAACAGCATTGAAGAATTGGCACCACACAGCAAAGAAACATGTAAAGGATTAAAGCAAGCATTCTAATCCAGTGACACCAATGTCAAGTAGACCAGGGACACCTTCTCATCATGGCATGTCACCCGTGCATTTATTGCGCGGACACTATAGGAGTGATATGGGCAGTCTACAAAACTCACCTCGTAGATCAAACTACGATGTTGATCATTGGGACAACGAGGGCTCACCTTCACCCTCCCGATTTTACCAGGAGGCTGCCGATGGCTCGTTGCACCAAATTCAACTTGGTCAGTTGGACCATGAATCGCAAGAAGTTATCGGGCCTAATTCGTCACAAGTGGTTCCTCTACCACATGAGGGCCACGACCAACATGAGATCACTATTGCTGGATCAAGAGATTTTTCGTTTGAGAAAAGAACAACCAgtatatagatattatttaattaacaaggggcacattatattctagattatttttattaatttATACTTGATTTCGGAGATATGACGATTGTAAATTTGATCCTAATTGCAACAATGGATCTCTGCAATTATGAGATGGAAAACTTGATCTGAAAATTCTACTAAATGCGAAAAAGATATTTAATTTTTCCGTTTTCAATTGTGGTCAGGATGATAATAAATTGTAGGAGTGCCAAAATGTTAGAGCGGATTAAAATT


Protein sequences

Name Description Sequence
Stu.11662 translated coding region predicted by ESTScan from UniGene Stu.11662

MGVLIQILCSYVTLPLYALVTQMGSNMKSTIFNERVATALKNWHHTAKKHVKDXSKHSNPVTPMSSRPGTPSHHGMSPVHLLRGHYRSDMGSLQNSPRRSNYDVDHWDNEGSPSPSRFYQEAADGSLHQIQLGQLDHESQEVIGPNSSQVVPLPHEGHDQHEITIAGSRDFSFEKRTTSI

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
1-84 Mlo
Mlo-related protein

MGVLIQILCSYVTLPLYALVTQMGSNMKSTIFNERVATALKNWHHTAKKHVKDXSKHSNPVTPMSSRPGTPSHHGMSPVHLLRG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox