PRGDB00077281 (Stu.13464)

From PRG Wiki
Jump to: navigation, search
Stu.13464
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 10445933 (BE919857)
Gene Class T
Domain Type TIR, LRR
Gene Species Solanum tuberosum

Comment?

EST423626 potato leaves and petioles Solanum tuberosum cDNA clone cSTB2L24 5' sequence, mRNA sequence

DNA Sequence

GATTGTAACTAATATTCTTCAACAATGTCACACACTTCTTCTTCTAAAATTCAAAAGTACGATGTTTTTCTGAGTTTTAGAGGTGAAGATACACGCAGATCATTCGCGAGTCATCTCCATAACGCTTTAATACAAGGAGGAATTAATGTTTTCAAAGACGATGAACGTCTAGAAACTGGAAAATCAATTTCTGATGAACTACCAAAAGCCATAGAAGAGTCTAAATTTGCTATAGTGATATTTTCTGAAAGCTATGCATCGTCAAAATGGTGTTTAGACGAGCTTGCACACATCATAAAGTGTCGAAAGGAATTGGATCAAATCGTAATTCCTATTTTCTTTAATGTGGATCCATCAGATGTGAGTCATCAAACTCAAACTTTTGCTGAGTCTTTTTCCAAACATGAGGAAAAATATAAAGATGATATGGAGAAAATTCAAAGATGGAGGGATGCATTTGCTGAGTCTGGGAAAATAGTAGGGCACCATTTGCAAAATTACAAGAATGAGGCAGATTGCATCAAAAGGTTGTTGACAATCTAATGTCATCATTACATATTAAATCTGATGATGATGATGA


Protein sequences

Name Description Sequence
Stu.13464 translated coding region predicted by ESTScan from UniGene Stu.13464

MSHTSSSKIQKYDVFLSFRGEDTRRSFASHLHNALIQGGINVFKDDERLETGKSISDELPKAIEESKFAIVIFSESYASSKWCLDELAHIIKCRKELDQIVIPIFFNVDPSDVSHQTQTFAESFSKHEEKYKDDMEKIQRWRDAFAESGKIVGHHLQNYKNEADCIKRLLTI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-154 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

MSHTSSSKIQKYDVFLSFRGEDTRRSFASHLHNALIQGGINVFKDDERLETGKSISDELPKAIEESKFAIVIFSESYASSKWCLDELAHIIKCRKELDQIVIPIFFNVDPSDVSHQTQTFAESFSKHEEKYKDDMEKIQRWRDAFAESGKIVGH

ProfileScan: PS50104
IPR000157
10-151 TIR
Toll-Interleukin receptor

QKYDVFLSFRGEDTRRSFASHLHNALIQGGINVFKDDERLETGKSISDELPKAIEESKFAIVIFSESYASSKWCLDELAHIIKCRKELDQIVIPIFFNVDPSDVSHQTQTFAESFSKHEEKYKDDMEKIQRWRDAFAESGKI

Gene3D: G3DSA:3.40.50.10140
10-143 no description

QKYDVFLSFRGEDTRRSFASHLHNALIQGGINVFKDDERLETGKSISDELPKAIEESKFAIVIFSESYASSKWCLDELAHIIKCRKELDQIVIPIFFNVDPSDVSHQTQTFAESFSKHEEKYKDDMEKIQRWRD

HMMSmart: SM00255
IPR000157
11-151 Toll
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFLSFRGEDTRRSFASHLHNALIQGGINVFKDDERLETGKSISDELPKAIEESKFAIVIFSESYASSKWCLDELAHIIKCRKELDQIVIPIFFNVDPSDVSHQTQTFAESFSKHEEKYKDDMEKIQRWRDAFAESGKI

HMMPfam: PF01582
IPR000157
14-145 TIR
Toll-Interleukin receptor

VFLSFRGEDTRRSFASHLHNALIQGGINVFKDDERLETGKSISDELPKAIEESKFAIVIFSESYASSKWCLDELAHIIKCRKELDQIVIPIFFNVDPSDVSHQTQTFAESFSKHEEKYKDDMEKIQRWRDAF

HMMPanther: PTHR23155:SF296
23-171 RPP1 (RECOGNITION OF PERONOSPORA PARASITICA 1)

TRRSFASHLHNALIQGGINVFKDDERLETGKSISDELPKAIEESKFAIVIFSESYASSKWCLDELAHIIKCRKELDQIVIPIFFNVDPSDVSHQTQTFAESFSKHEEKYKDDMEKIQRWRDAFAESGKIVGHHLQNYKNEADCIKRLLT

HMMPanther: PTHR23155
23-171 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRRSFASHLHNALIQGGINVFKDDERLETGKSISDELPKAIEESKFAIVIFSESYASSKWCLDELAHIIKCRKELDQIVIPIFFNVDPSDVSHQTQTFAESFSKHEEKYKDDMEKIQRWRDAFAESGKIVGHHLQNYKNEADCIKRLLT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox