PRGDB00077283 (Stu.13630)

From PRG Wiki
Jump to: navigation, search
Stu.13630
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 9562956 (BE472465)
Gene Class T
Domain Type TIR, LRR
Gene Species Solanum tuberosum

Comment?

EST417318 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA33F23, mRNA sequence

DNA Sequence

GGCCTGTTAGTCTTTAGCAATATTCGGAACAATGTCTCATGCTTCTTCTTCCAAAGTTTGCAAATATGATATCTTTTTGAGTTTTAGAGGTGAAGATACGTGTGGAACCTTTGTGAGTCATCTATATAAGGCTCTGGAACAAAGAGGAATCCACACTTTTAAAGATGATGAGCGGTTGGAAGCAGGAAAATCAATTTCTGCTGAACTTTTAAAAGCCATAGAAGAGGCCAGATTCGCTGTCGTAATATTTTCAAAAAGCTATGCATCGTCAAGATGGTGTTTAGAGGAGCTTGCACACATCATAAAGTGTAAAAAGGAATTGGAGCACATTGTGATTCCAGTCTTCTATGATGTGAGTCCATCAGATGTACGCCATCAAAATCCCCCTTTCGCTGATTCATTTTCCCAATACAAAGATGATATGGAGAAGGTTCAAAGATGGAGGGGTGCATTTGTGGAGGCAGGGAAAATATCAGGCTATCATTTATTTAATTTCAAGGATGAGGCAGAGTGCATCAAGAAACTAGTTGATGACATATT


Protein sequences

Name Description Sequence
Stu.13630 translated coding region predicted by ESTScan from UniGene Stu.13630

MSHASSSKVCKYDIFLSFRGEDTCGTFVSHLYKALEQRGIHTFKDDERLEAGKSISAELLKAIEEARFAVVIFSKSYASSRWCLEELAHIIKCKKELEHIVIPVFYDVSPSDVRHQNPPFADSFSQYKDDMEKVQRWRGAFVEAGKISGYHLFNFKDEAECIKKLVDDIX

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-150 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

MSHASSSKVCKYDIFLSFRGEDTCGTFVSHLYKALEQRGIHTFKDDERLEAGKSISAELLKAIEEARFAVVIFSKSYASSRWCLEELAHIIKCKKELEHIVIPVFYDVSPSDVRHQNPPFADSFSQYKDDMEKVQRWRGAFVEAGKISGY

ProfileScan: PS50104
IPR000157
10-147 TIR
Toll-Interleukin receptor

CKYDIFLSFRGEDTCGTFVSHLYKALEQRGIHTFKDDERLEAGKSISAELLKAIEEARFAVVIFSKSYASSRWCLEELAHIIKCKKELEHIVIPVFYDVSPSDVRHQNPPFADSFSQYKDDMEKVQRWRGAFVEAGKI

Gene3D: G3DSA:3.40.50.10140
10-126 no description

CKYDIFLSFRGEDTCGTFVSHLYKALEQRGIHTFKDDERLEAGKSISAELLKAIEEARFAVVIFSKSYASSRWCLEELAHIIKCKKELEHIVIPVFYDVSPSDVRHQNPPFADSFSQ

HMMSmart: SM00255
IPR000157
11-147 Toll
Toll/interleukin-1 receptor homology (TIR) domain

KYDIFLSFRGEDTCGTFVSHLYKALEQRGIHTFKDDERLEAGKSISAELLKAIEEARFAVVIFSKSYASSRWCLEELAHIIKCKKELEHIVIPVFYDVSPSDVRHQNPPFADSFSQYKDDMEKVQRWRGAFVEAGKI

HMMPfam: PF01582
IPR000157
15-139 TIR
Toll-Interleukin receptor

FLSFRGEDTCGTFVSHLYKALEQRGIHTFKDDERLEAGKSISAELLKAIEEARFAVVIFSKSYASSRWCLEELAHIIKCKKELEHIVIPVFYDVSPSDVRHQNPPFADSFSQYKDDMEKVQRWRG

HMMPanther: PTHR23155:SF344
26-169 SUBFAMILY NOT NAMED

TFVSHLYKALEQRGIHTFKDDERLEAGKSISAELLKAIEEARFAVVIFSKSYASSRWCLEELAHIIKCKKELEHIVIPVFYDVSPSDVRHQNPPFADSFSQYKDDMEKVQRWRGAFVEAGKISGYHLFNFKDEAECIKKLVDDI

HMMPanther: PTHR23155
26-169 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TFVSHLYKALEQRGIHTFKDDERLEAGKSISAELLKAIEEARFAVVIFSKSYASSRWCLEELAHIIKCKKELEHIVIPVFYDVSPSDVRHQNPPFADSFSQYKDDMEKVQRWRGAFVEAGKISGYHLFNFKDEAECIKKLVDDI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox