PRGDB00077284 (Stu.13648)

From PRG Wiki
Jump to: navigation, search
Stu.13648
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21918923 (BQ118482)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

EST604058 mixed potato tissues Solanum tuberosum cDNA clone STMEB21 5' end, mRNA sequence

DNA Sequence

tctctctcttctttctctctctATATTTTAGGGCATCGTATACAGGCAAAAGAGGGATATGGCGATTGCACCGGAGACTCAGCCACAGCAACATCCGAAGGATTCCTCTGAGGGTGCGGCGGTGGACCAAAAGAGATGGACTCTGAATGATTTTGACATTGGAAAGCCTCTTGGAAGAGGAAAATTTGGTCATGTATATTTAGCTAGGGAGAAAAGGAGCAATCATATTGTTGCACTAAAAGTGCTTTTCAAGAACCAACTGAAACAGTCCCAAGTTGAGCATCAGCTTCGTCGTGAGGTAGAAATACAAAGCCACCTTCGGCATCCAAATATCCTGAGACTGTATGGTTACTTTTATGATCAGAAACGGGTTTATTTGATTCTGGAATATGCTGCCAAGGGTGAACTCTATAAGGAGCTGCAAAAATGCAAATATTTTAGTGAAAGGCGTGCTGCAACTTATGTTGCATCATTGGCGCGAGCCCTCATATACTGTCACGGGAAGCATGTGATACATAGAGATATTAAGCCAGAGAACCTTTTGGTTGGTGCACAGGGTGAACTTAAAATTGCAGACTTTGGTTGGTCGGTACACACCTTCAATCGCAGACGCACTATGTGTGGCACTCTAGACTATTTGCCACCTGAGATGGTGGAAAGTGTGGAGCATGATGCAAATGTGGACATTTGGGAGCCTGGTATTCTCTGCTATGAATTCCTATATGGGGTGCCTCCATTTGAAGCAAAGGAACACTCGGACACATAT


Protein sequences

Name Description Sequence
Stu.13648 translated coding region predicted by ESTScan from UniGene Stu.13648

MAIAPETQPQQHPKDSSEGAAVDQKRWTLNDFDIGKPLGRGKFGHVYLAREKRSNHIVALKVLFKNQLKQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQKCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLVGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVESVEHDANVDIWEPGILCYEFLYGVPPFEAKEHSDTY

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
6-98 no description

ETQPQQHPKDSSEGAAVDQKRWTLNDFDIGKPLGRGKFGHVYLAREKRSNHIVALKVLFKNQLKQSQVEHQLRREVEIQSHLRHPNILRLYGY

superfamily: SSF56112
IPR011009
7-236 Protein kinase-like (PK-like)
Protein kinase-like domain

TQPQQHPKDSSEGAAVDQKRWTLNDFDIGKPLGRGKFGHVYLAREKRSNHIVALKVLFKNQLKQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQKCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLVGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVESVEHDANVDIWEPGILCYEFLYGVPPFEAKEHSDTY

HMMPanther: PTHR24350
24-236 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE IAL-RELATED

QKRWTLNDFDIGKPLGRGKFGHVYLAREKRSNHIVALKVLFKNQLKQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQKCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLVGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVESVEHDANVDIWEPGILCYEFLYGVPPFEAKEHSDTY

ProfileScan: PS50011
IPR000719
32-236 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDIGKPLGRGKFGHVYLAREKRSNHIVALKVLFKNQLKQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQKCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLVGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVESVEHDANVDIWEPGILCYEFLYGVPPFEAKEHSDTY

HMMSmart: SM00219
IPR020635
32-236 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDIGKPLGRGKFGHVYLAREKRSNHIVALKVLFKNQLKQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQKCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLVGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVESVEHDANVDIWEPGILCYEFLYGVPPFEAKEHSDTY

HMMSmart: SM00220
IPR002290
32-235 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDIGKPLGRGKFGHVYLAREKRSNHIVALKVLFKNQLKQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQKCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLVGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVESVEHDANVDIWEPGILCYEFLYGVPPFEAKEHSDT

HMMPfam: PF00069
IPR017442
33-233 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

DIGKPLGRGKFGHVYLAREKRSNHIVALKVLFKNQLKQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQKCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLVGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVESVEHDANVDIWEPGILCYEFLYGVPPFEAKEHS

PatternScan: PS00107
IPR017441
38-61 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGKFGHVYLAREKRSNHIVALK

Gene3D: G3DSA:1.10.510.10
99-235 no description

FYDQKRVYLILEYAAKGELYKELQKCKYFSERRAATYVASLARALIYCHGKHVIHRDIKPENLLVGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVESVEHDANVDIWEPGILCYEFLYGVPPFEAKEHSDT

PatternScan: PS00108
IPR008271
151-163 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKPENLLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox