PRGDB00077293 (Stu.14136)

From PRG Wiki
Jump to: navigation, search
Stu.14136
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21919123 (BQ118809)
Gene Class Unknown
Domain Type LRR
Gene Species Solanum tuberosum

Comment?

EST604385 mixed potato tissues Solanum tuberosum cDNA clone STMEE72 5' end, mRNA sequence

DNA Sequence

GCTAACGCATGCTGGGATTGGTACGGAGTTATATGCTTTAATGATAGGGTAAACAGGTTAAATATTACAAATTCTAGTGTCATTGGTACCCTCTATGATTTTCCATTTTCATCCCTCCCTTTTCTTGAATATGTTGATCTTAGCATGAACAATCTATCCGGAACCATTCCACCTAAGATTGGTAATCTCACTAATCTTGTCTATCTTGACTTGTCCATCAATCAGATTTCAGGCACAATCCCACCTCAAATCGGCTCACTAGCTAAGCTGGAGATCCTCCACATCTTTGACAACCATTTAAATGGTTCCATTCCTAAGGAAATAGGTTATCTAAGGTCTCTTACTGAGCTATCTATGAGTAGAAATTTTCTTAATGGTTCTATTCCTGCTTCATTGGGGAATTTGAACGACTTGTCCGATTTGCATCTTTATAAGAATAACCTTTCTGGCCTAATTCCTAGTGAGCTGGGGAATCTGAAAAACCTCAATTATCTGGTATTATCCAATAATCAACTCACTGGTTCTATTCCTGCTTCATTGGGGAATTTGAACGACTTGTCCTATTTGGTTCTTTATAACAATAACCTTTCTGGCCTAATTCCTAGTGAGCTGGGGAATCTGAAAAACCTCAATTATCTGGTATTATCCAATAATCAACTCACTGGTTCTATTCCTGCTTCATTGGGGAAATTGAACGACTTGTCCTATTTGTTTCTTT


Protein sequences

Name Description Sequence
Stu.14136 translated coding region predicted by ESTScan from UniGene Stu.14136

ANACWDWYGVICFNDRVNRLNITNSSVIGTLYDFPFSSLPFLEYVDLSMNNLSGTIPPKIGNLTNLVYLDLSINQISGTIPPQIGSLAKLEILHIFDNHLNGSIPKEIGYLRSLTELSMSRNFLNGSIPASLGNLNDLSDLHLYKNNLSGLIPSELGNLKNLNYLVLSNNQLTGSIPASLGNLNDLSYLVLYNNNLSGLIPSELGNLKNLNYLVLSNNQLTGSIPASLGKLNDLSYLFLX


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
4-239 L domain-like,LRR

CWDWYGVICFNDRVNRLNITNSSVIGTLYDFPFSSLPFLEYVDLSMNNLSGTIPPKIGNLTNLVYLDLSINQISGTIPPQIGSLAKLEILHIFDNHLNGSIPKEIGYLRSLTELSMSRNFLNGSIPASLGNLNDLSDLHLYKNNLSGLIPSELGNLKNLNYLVLSNNQLTGSIPASLGNLNDLSYLVLYNNNLSGLIPSELGNLKNLNYLVLSNNQLTGSIPASLGKLNDLSYLFL

Gene3D: G3DSA:3.80.10.10
6-239 no description

DWYGVICFNDRVNRLNITNSSVIGTLYDFPFSSLPFLEYVDLSMNNLSGTIPPKIGNLTNLVYLDLSINQISGTIPPQIGSLAKLEILHIFDNHLNGSIPKEIGYLRSLTELSMSRNFLNGSIPASLGNLNDLSDLHLYKNNLSGLIPSELGNLKNLNYLVLSNNQLTGSIPASLGNLNDLSYLVLYNNNLSGLIPSELGNLKNLNYLVLSNNQLTGSIPASLGKLNDLSYLFL

HMMPanther: PTHR24420
7-239 FAMILY NOT NAMED,FAMILY NOT NAMED

WYGVICFNDRVNRLNITNSSVIGTLYDFPFSSLPFLEYVDLSMNNLSGTIPPKIGNLTNLVYLDLSINQISGTIPPQIGSLAKLEILHIFDNHLNGSIPKEIGYLRSLTELSMSRNFLNGSIPASLGNLNDLSDLHLYKNNLSGLIPSELGNLKNLNYLVLSNNQLTGSIPASLGNLNDLSYLVLYNNNLSGLIPSELGNLKNLNYLVLSNNQLTGSIPASLGKLNDLSYLFL

HMMSmart: SM00369
IPR003591
39-62 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPFLEYVDLSMNNLSGTIPPKIGN

HMMPfam: PF12799
42-77 LRR_4,Leucine Rich repeats (2 copies)

LEYVDLSMNNLSGTIPPKIGNLTNLVYLDLSINQIS

HMMSmart: SM00369
IPR003591
63-87 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNLVYLDLSINQISGTIPPQIGSL

FPrintScan: PR00019
66-79 LEURICHRPT,Leucine-rich repeat signature

LVYLDLSINQISGT

HMMSmart: SM00369
IPR003591
111-135 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRSLTELSMSRNFLNGSIPASLGNL

HMMPfam: PF00560
IPR001611
113-135 LRR_1
Leucine-rich repeat

SLTELSMSRNFLNGSIPASLGNL

FPrintScan: PR00019
159-172 LEURICHRPT,Leucine-rich repeat signature

LKNLNYLVLSNNQL

HMMSmart: SM00369
IPR003591
159-183 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLNYLVLSNNQLTGSIPASLGNL

HMMPfam: PF13855
161-220 LRR_8,Leucine rich repeat

NLNYLVLSNNQLTGSIPASLGNLNDLSYLVLYNNNLSGLIPSELGNLKNLNYLVLSNNQL

Seg: seg
182-197 seg

NLNDLSYLVLYNNNLS

HMMSmart: SM00369
IPR003591
207-231 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLNYLVLSNNQLTGSIPASLGKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox