PRGDB00077295 (Stu.14259)

From PRG Wiki
Jump to: navigation, search
Stu.14259
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21919632 (BQ119714)
Gene Class T
Domain Type TIR, LRR
Gene Species Solanum tuberosum

Comment?

EST605290 mixed potato tissues Solanum tuberosum cDNA clone STMEM17 5' end, mRNA sequence

DNA Sequence

GCTGAATTGTCAATACAAGGACTTTGTCCAAAATATCATCAATTGATCTCATCCATTTCTATGGCATCTTCTTCTTCTTCTGCGAGTAATTCAAAGTATTGTCCTCGATGGAAGTACGTTGTGTTTCTAAGCTTCAGAGGTGAAGACACTCGAAAAACATTTACGGGTCATTTGTATGAAGGTTTGAAAAATAGGGGAATAAGCACCTTTCAAGATGATAAAAGGCTAGAGCATGGAGATTCAATTCCGAAAGAACTCTTGAGAGCTATCGAAGAGTCTCAAGTTGCACTTATTGTCTTCTCAAAGAATTATGCTACATCTAGGTGGTGCTTGAATGAACTAGTGAAGATCATGGAATGCAAAGATGAAGAAAATGGACAAACAGTCATACCAATCTTCTATGATGTGGATCCATCACATGTTCGAAACCAAAGTGAAAGCTTTGGAGCAGCATTTGCCGAACATGAATTAAAGTATAAGGATGATGTTGAGGGGATGCAAAAGGTGCAAAGATGGAGAAATGCCCTAACTGTTGCCGCAAATCTAAAAGGATATGATATCCGTGACGGGATTGAATCAGAGAATATTCAACAGATCGTAGACTGCATCTCTTCCAAGTTTCGCACAAATGCTTATTCTTTATCTTTTTTGCAAGATGTTGTGGGAATAAACGATCACTTAGAGAAACTAAAATCCAAACTTCAAATGGAAATCAACGATGGTTCGGATTTTAAGGATCTGGGG


Protein sequences

Name Description Sequence
Stu.14259 translated coding region predicted by ESTScan from UniGene Stu.14259

AELSIQGLCPKYHQLISSISMASSSSSASNSKYCPRWKYVVFLSFRGEDTRKTFTGHLYEGLKNRGISTFQDDKRLEHGDSIPKELLRAIEESQVALIVFSKNYATSRWCLNELVKIMECKDEENGQTVIPIFYDVDPSHVRNQSESFGAAFAEHELKYKDDVEGMQKVQRWRNALTVAANLKGYDIRDGIESENIQQIVDCISSKFRTNAYSLSFLQDVVGINDHLEKLKSKLQMEINDGSDFKDLG

Domains

Domain Start-End Description Sequence

Seg: seg
16-31 seg

ISSISMASSSSSASNS

superfamily: SSF52200
IPR000157
27-185 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

SASNSKYCPRWKYVVFLSFRGEDTRKTFTGHLYEGLKNRGISTFQDDKRLEHGDSIPKELLRAIEESQVALIVFSKNYATSRWCLNELVKIMECKDEENGQTVIPIFYDVDPSHVRNQSESFGAAFAEHELKYKDDVEGMQKVQRWRNALTVAANLKGY

Gene3D: G3DSA:3.40.50.10140
36-175 no description

RWKYVVFLSFRGEDTRKTFTGHLYEGLKNRGISTFQDDKRLEHGDSIPKELLRAIEESQVALIVFSKNYATSRWCLNELVKIMECKDEENGQTVIPIFYDVDPSHVRNQSESFGAAFAEHELKYKDDVEGMQKVQRWRNA

ProfileScan: PS50104
IPR000157
37-182 TIR
Toll-Interleukin receptor

WKYVVFLSFRGEDTRKTFTGHLYEGLKNRGISTFQDDKRLEHGDSIPKELLRAIEESQVALIVFSKNYATSRWCLNELVKIMECKDEENGQTVIPIFYDVDPSHVRNQSESFGAAFAEHELKYKDDVEGMQKVQRWRNALTVAANL

HMMSmart: SM00255
IPR000157
38-182 Toll
Toll/interleukin-1 receptor homology (TIR) domain

KYVVFLSFRGEDTRKTFTGHLYEGLKNRGISTFQDDKRLEHGDSIPKELLRAIEESQVALIVFSKNYATSRWCLNELVKIMECKDEENGQTVIPIFYDVDPSHVRNQSESFGAAFAEHELKYKDDVEGMQKVQRWRNALTVAANL

HMMPfam: PF01582
IPR000157
41-176 TIR
Toll-Interleukin receptor

VFLSFRGEDTRKTFTGHLYEGLKNRGISTFQDDKRLEHGDSIPKELLRAIEESQVALIVFSKNYATSRWCLNELVKIMECKDEENGQTVIPIFYDVDPSHVRNQSESFGAAFAEHELKYKDDVEGMQKVQRWRNAL

HMMPanther: PTHR23155:SF344
50-240 SUBFAMILY NOT NAMED

TRKTFTGHLYEGLKNRGISTFQDDKRLEHGDSIPKELLRAIEESQVALIVFSKNYATSRWCLNELVKIMECKDEENGQTVIPIFYDVDPSHVRNQSESFGAAFAEHELKYKDDVEGMQKVQRWRNALTVAANLKGYDIRDGIESENIQQIVDCISSKFRTNAYSLSFLQDVVGINDHLEKLKSKLQMEIND

HMMPanther: PTHR23155
50-240 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRKTFTGHLYEGLKNRGISTFQDDKRLEHGDSIPKELLRAIEESQVALIVFSKNYATSRWCLNELVKIMECKDEENGQTVIPIFYDVDPSHVRNQSESFGAAFAEHELKYKDDVEGMQKVQRWRNALTVAANLKGYDIRDGIESENIQQIVDCISSKFRTNAYSLSFLQDVVGINDHLEKLKSKLQMEIND






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox