PRGDB00077300 (Stu.14488)

From PRG Wiki
Jump to: navigation, search
Stu.14488
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21915759 (BQ113052)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

EST598628 mixed potato tissues Solanum tuberosum cDNA clone STMCL05 5' end, mRNA sequence

DNA Sequence

GCATGCATCTCATCCAGCAGAGCGAGTTTCAATTTCTAAAGCTGCTATACTTGGTATTGCTCTGGGTGGCTTGGTGATTCTTCTGATGATACTAGTAGCAGCATGCCGGCCACAGAATCCTGCACCTTTCATGGAAGGATCTATTGATAAACCAGTTTATTACTCATCTCCAAAGCTTGTGATCCTTCATATGAACATGGCACTTCATGTTTACGAGGACATTATGAGGATGACTGAGAACTTGAGTGAGAAGTATATAATTGGTTGTGGAGCATCAAGTACTGTATATAAATGTGTTTTGAAAAATTGCAAGCCTGTAGCTATCAAGAAATTGTACTCTCACAACCCGCAATACTTGAAGGAATTTGAGACTGAACTTGAGACAGTTGGGAGTATTAAGCATCGTAATCTTGTCTGCCTCCAAGGATATTCTCTTTCTCCATCTGGCCATCTTCTTTTCTATGACTACATGGAAAATGGTAGCCTTTGGGATTTGCTTCATGGTCCTACAACAAAGAAGAAAAAGCTTGATTGGGTTACTCGCCTTCGAATTGCATTGGGATCAGCTCAAGGGCTTGCATATCTTCACCATGATTGTAGCCCTCGAATTATCCACCGTGATGTTAAATCATCAAATATCTTGTTG


Protein sequences

Name Description Sequence
Stu.14488 translated coding region predicted by ESTScan from UniGene Stu.14488

XHASHPAERVSISKAAILGIALGGLVILLMILVAACRPQNPAPFMEGSIDKPVYYSSPKLVILHMNMALHVYEDIMRMTENLSEKYIIGCGASSTVYKCVLKNCKPVAIKKLYSHNPQYLKEFETELETVGSIKHRNLVCLQGYSLSPSGHLLFYDYMENGSLWDLLHGPTTKKKKLDWVTRLRIALGSAQGLAYLHHDCSPRIIHRDVKSSNILL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF826
9-216 OS02G0777400 PROTEIN (FRAGMENT)

RVSISKAAILGIALGGLVILLMILVAACRPQNPAPFMEGSIDKPVYYSSPKLVILHMNMALHVYEDIMRMTENLSEKYIIGCGASSTVYKCVLKNCKPVAIKKLYSHNPQYLKEFETELETVGSIKHRNLVCLQGYSLSPSGHLLFYDYMENGSLWDLLHGPTTKKKKLDWVTRLRIALGSAQGLAYLHHDCSPRIIHRDVKSSNILL

HMMPanther: PTHR24420
9-216 FAMILY NOT NAMED,FAMILY NOT NAMED

RVSISKAAILGIALGGLVILLMILVAACRPQNPAPFMEGSIDKPVYYSSPKLVILHMNMALHVYEDIMRMTENLSEKYIIGCGASSTVYKCVLKNCKPVAIKKLYSHNPQYLKEFETELETVGSIKHRNLVCLQGYSLSPSGHLLFYDYMENGSLWDLLHGPTTKKKKLDWVTRLRIALGSAQGLAYLHHDCSPRIIHRDVKSSNILL

Seg: seg
15-35 seg

AAILGIALGGLVILLMILVAA

superfamily: SSF56112
IPR011009
52-216 Protein kinase-like (PK-like)
Protein kinase-like domain

PVYYSSPKLVILHMNMALHVYEDIMRMTENLSEKYIIGCGASSTVYKCVLKNCKPVAIKKLYSHNPQYLKEFETELETVGSIKHRNLVCLQGYSLSPSGHLLFYDYMENGSLWDLLHGPTTKKKKLDWVTRLRIALGSAQGLAYLHHDCSPRIIHRDVKSSNILL

Gene3D: G3DSA:3.30.200.20
69-145 no description

LHVYEDIMRMTENLSEKYIIGCGASSTVYKCVLKNCKPVAIKKLYSHNPQYLKEFETELETVGSIKHRNLVCLQGYS

ProfileScan: PS50011
IPR000719
82-216 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LSEKYIIGCGASSTVYKCVLKNCKPVAIKKLYSHNPQYLKEFETELETVGSIKHRNLVCLQGYSLSPSGHLLFYDYMENGSLWDLLHGPTTKKKKLDWVTRLRIALGSAQGLAYLHHDCSPRIIHRDVKSSNILL

HMMSmart: SM00219
IPR020635
82-215 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LSEKYIIGCGASSTVYKCVLKNCKPVAIKKLYSHNPQYLKEFETELETVGSIKHRNLVCLQGYSLSPSGHLLFYDYMENGSLWDLLHGPTTKKKKLDWVTRLRIALGSAQGLAYLHHDCSPRIIHRDVKSSNIL

HMMPfam: PF00069
IPR017442
86-216 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YIIGCGASSTVYKCVLKNCKPVAIKKLYSHNPQYLKEFETELETVGSIKHRNLVCLQGYSLSPSGHLLFYDYMENGSLWDLLHGPTTKKKKLDWVTRLRIALGSAQGLAYLHHDCSPRIIHRDVKSSNILL

PatternScan: PS00107
IPR017441
88-111 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGCGASSTVYKCVLKNCKPVAIKK

Gene3D: G3DSA:1.10.510.10
146-216 no description

LSPSGHLLFYDYMENGSLWDLLHGPTTKKKKLDWVTRLRIALGSAQGLAYLHHDCSPRIIHRDVKSSNILL

PatternScan: PS00108
IPR008271
204-216 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox