PRGDB00077301 (Stu.14489)

From PRG Wiki
Jump to: navigation, search
Stu.14489
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21915766 (BQ113067)
Gene Class Unknown
Domain Type LRR
Gene Species Solanum tuberosum

Comment?

EST598643 mixed potato tissues Solanum tuberosum cDNA clone STMCL13 5' end, mRNA sequence

DNA Sequence

GCTTACCCACCTCCATCTGGAAATCAAAGAAATTACGGCATCTCAATCTCAGTCACATCCGTCTTGACATGCCAAAGCATTCAGATACCGATTCTTTGCCTACACTCCTTACACTGTGGGGATTGTCCGTAGATGATGATAGCCCAGTGAAGAATGGACTGGATCGGTTGCGTAATCTTAGAGAGGCAGGCATTACTTTCTGTTTGAAGAATTGCGACCACCTTCTCAACTGGATTTCAAATTTAACTTCTCTTCAATCATTGAGGTTACGATCCATAAATGATGTAGGACATCCATCACATTTTGGTGACGAGCCGTTGTCTCTGTCAAGTCTGAGCAATCTTTCCCACCTAAACTTGCTAGGTAAATTACCAAATCTGCCTGACTTACCTGAAGGACTTAAAGTAGTCACATTGTCTCTTTCAAAGCTGACAGAGGATCCTATGCCGATTCTTGGGAAGCTTGAACATCTTAATGTCCTCAGGCTTCTATCAGATTCCTATATGGGGAAGGAATTGGTGTGCCCTCAGGGAGGATTCAAAGAGCTTCGGGTTCTAAAGATTTGGAAACTGAAGAACTTGGAAAAGTGGAACGTGGAGGAAGCGGAAATGGAGAAGCTCAAAGAGATAAATATCCGATGCTGTAATAAACTGATGACCATTCCCCGAAGACTGGGGAAAAAACGAAGTCTCAGGGAATTGATCATAACCAACATGCCAGAGGAGTTCAAAGAGAATGTCCATCAGTCATGAAGCGTCG


Protein sequences

Name Description Sequence
Stu.14489 translated coding region predicted by ESTScan from UniGene Stu.14489

XLPTSIWKSKKLRHLNLSHIRLDMPKHSDTDSLPTLLTLWGLSVDDDSPVKNGLDRLRNLREAGITFCLKNCDHLLNWISNLTSLQSLRLRSINDVGHPSHFGDEPLSLSSLSNLSHLNLLGKLPNLPDLPEGLKVVTLSLSKLTEDPMPILGKLEHLNVLRLLSDSYMGKELVCPQGGFKELRVLKIWKLKNLEKWNVEEAEMEKLKEINIRCCNKLMTIPRRLGKKRSLRELIITNMPEEFKENVHQSXSVX

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-241 L domain-like,LRR

XLPTSIWKSKKLRHLNLSHIRLDMPKHSDTDSLPTLLTLWGLSVDDDSPVKNGLDRLRNLREAGITFCLKNCDHLLNWISNLTSLQSLRLRSINDVGHPSHFGDEPLSLSSLSNLSHLNLLGKLPNLPDLPEGLKVVTLSLSKLTEDPMPILGKLEHLNVLRLLSDSYMGKELVCPQGGFKELRVLKIWKLKNLEKWNVEEAEMEKLKEINIRCCNKLMTIPRRLGKKRSLRELIITNMPE

HMMPanther: PTHR23155:SF121
2-253 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LPTSIWKSKKLRHLNLSHIRLDMPKHSDTDSLPTLLTLWGLSVDDDSPVKNGLDRLRNLREAGITFCLKNCDHLLNWISNLTSLQSLRLRSINDVGHPSHFGDEPLSLSSLSNLSHLNLLGKLPNLPDLPEGLKVVTLSLSKLTEDPMPILGKLEHLNVLRLLSDSYMGKELVCPQGGFKELRVLKIWKLKNLEKWNVEEAEMEKLKEINIRCCNKLMTIPRRLGKKRSLRELIITNMPEEFKENVHQSXSV

HMMPanther: PTHR23155
2-253 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LPTSIWKSKKLRHLNLSHIRLDMPKHSDTDSLPTLLTLWGLSVDDDSPVKNGLDRLRNLREAGITFCLKNCDHLLNWISNLTSLQSLRLRSINDVGHPSHFGDEPLSLSSLSNLSHLNLLGKLPNLPDLPEGLKVVTLSLSKLTEDPMPILGKLEHLNVLRLLSDSYMGKELVCPQGGFKELRVLKIWKLKNLEKWNVEEAEMEKLKEINIRCCNKLMTIPRRLGKKRSLRELIITNMPEEFKENVHQSXSV

Gene3D: G3DSA:3.80.10.10
3-122 no description

PTSIWKSKKLRHLNLSHIRLDMPKHSDTDSLPTLLTLWGLSVDDDSPVKNGLDRLRNLREAGITFCLKNCDHLLNWISNLTSLQSLRLRSINDVGHPSHFGDEPLSLSSLSNLSHLNLLG

Seg: seg
28-39 seg

SDTDSLPTLLTL

Seg: seg
106-131 seg

PLSLSSLSNLSHLNLLGKLPNLPDLP

Gene3D: G3DSA:3.80.10.10
132-245 no description

EGLKVVTLSLSKLTEDPMPILGKLEHLNVLRLLSDSYMGKELVCPQGGFKELRVLKIWKLKNLEKWNVEEAEMEKLKEINIRCCNKLMTIPRRLGKKRSLRELIITNMPEEFKE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox