PRGDB00077303 (Stu.14593)

From PRG Wiki
Jump to: navigation, search
Stu.14593
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21915407 (BQ112353)
Gene Class Unknown
Domain Type NBS
Gene Species Solanum tuberosum

Comment?

EST597929 mixed potato tissues Solanum tuberosum cDNA clone STMCG67 5' end, mRNA sequence

DNA Sequence

AAAGTAAGAAACAGAGCTAAAGCTACTTAACCAAAAAACAGAGCAACTCTCAGTGTGAGAAACTTTTACACTTTTtcaaaagtgtaaagtgagaaaacaagaaaaaaagtTTAGGCTTTTAAATGGGTTCTTGTAAAGAAGAAGAACCAAAATGGTTGTGGGTTAATGGACCTATTATAGTAGGTGCAGGTCCTTCTGGTTTAGCAGTTTCAGCTTGTCTTAAAGAAAATGGAGTCCCTTCACTCATTCTTGAGAGAAGTGATTGTATTGCTTCTTTATGGCAACAAAAGACTTATGATCGCTTAAAACTTCATCTTCCTAAACAATTCTGTCAACTCCCATTGTTTGATTTCCCTGAAAATTTCCCAAAATACCCCACAAAACACCAGTTCATTTCTTACCTTGAATCTTATGCTAAACACTTTTCAATCACCCCCAAGTTCAAACAGAGTGTTAAAAATGCAGAATTTGATGAAGTTTGTGGGTTTTGGAAAGTAGAAACTCAAGATTTTCAGTATTTGTCGAAATGGTTGATTGTTGCAACAGGGGAAAATGCAGAGGCAGTTATTCCAGAAATTCCAGGGATTGATAAGTTTAAAGGAAGATTAATGCATACAAGTGTTTATAAATCTGGTACTGAGTTTATTAATCAAAGGGTTTTGGTAATAGGTTGTGGAAATTCTGGTATGGAAGTTAGCTTAGACCTTTGTAGACATAACGCCATTCCTCATATGGTGGTCAGAAATTCTGTGCATATTTTACCTAGGGGAATGTTAGGAATATCAACATTTTCAATAGCTATGGCACTTCTAAAATGGATGCCTTTAAGAAT


Protein sequences

Name Description Sequence
Stu.14593 translated coding region predicted by ESTScan from UniGene Stu.14593

MGSCKEEEPKWLWVNGPIIVGAGPSGLAVSACLKENGVPSLILERSDCIASLWQQKTYDRLKLHLPKQFCQLPLFDFPENFPKYPTKHQFISYLESYAKHFSITPKFKQSVKNAEFDEVCGFWKVETQDFQYLSKWLIVATGENAEAVIPEIPGIDKFKGRLMHTSVYKSGTEFINQRVLVIGCGNSGMEVSLDLCRHNAIPHMVVRNSVHILPRGMLGISTFSIAMALLKWMPLRX

Domains

Domain Start-End Description Sequence

ProfileScan: PS51257
1-32 PROKAR_LIPOPROTEIN,Prokaryotic membrane lipoprotein lipid attachment site profile.

MGSCKEEEPKWLWVNGPIIVGAGPSGLAVSAC

HMMPanther: PTHR23023:SF5
5-236 MONOOXYGENASE,MONOOXYGENASE

KEEEPKWLWVNGPIIVGAGPSGLAVSACLKENGVPSLILERSDCIASLWQQKTYDRLKLHLPKQFCQLPLFDFPENFPKYPTKHQFISYLESYAKHFSITPKFKQSVKNAEFDEVCGFWKVETQDFQYLSKWLIVATGENAEAVIPEIPGIDKFKGRLMHTSVYKSGTEFINQRVLVIGCGNSGMEVSLDLCRHNAIPHMVVRNSVHILPRGMLGISTFSIAMALLKWMPLR

HMMPanther: PTHR23023
5-236 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

KEEEPKWLWVNGPIIVGAGPSGLAVSACLKENGVPSLILERSDCIASLWQQKTYDRLKLHLPKQFCQLPLFDFPENFPKYPTKHQFISYLESYAKHFSITPKFKQSVKNAEFDEVCGFWKVETQDFQYLSKWLIVATGENAEAVIPEIPGIDKFKGRLMHTSVYKSGTEFINQRVLVIGCGNSGMEVSLDLCRHNAIPHMVVRNSVHILPRGMLGISTFSIAMALLKWMPLR

FPrintScan: PR00469
IPR000103
16-38 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

GPIIVGAGPSGLAVSACLKENGV

FPrintScan: PR00368
IPR013027
17-36 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

PIIVGAGPSGLAVSACLKEN

superfamily: SSF51905
18-199 FAD/NAD(P)-binding domain

IIVGAGPSGLAVSACLKENGVPSLILERSDCIASLWQQKTYDRLKLHLPKQFCQLPLFDFPENFPKYPTKHQFISYLESYAKHFSITPKFKQSVKNAEFDEVCGFWKVETQDFQYLSKWLIVATGENAEAVIPEIPGIDKFKGRLMHTSVYKSGTEFINQRVLVIGCGNSGMEVSLDLCRHN

Gene3D: G3DSA:3.50.50.60
18-201 no description

IIVGAGPSGLAVSACLKENGVPSLILERSDCIASLWQQKTYDRLKLHLPKQFCQLPLFDFPENFPKYPTKHQFISYLESYAKHFSITPKFKQSVKNAEFDEVCGFWKVETQDFQYLSKWLIVATGENAEAVIPEIPGIDKFKGRLMHTSVYKSGTEFINQRVLVIGCGNSGMEVSLDLCRHNAI

HMMPfam: PF00743
IPR020946
19-215 FMO-like
Flavin-containing monooxygenase-like

IVGAGPSGLAVSACLKENGVPSLILERSDCIASLWQQKTYDRLKLHLPKQFCQLPLFDFPENFPKYPTKHQFISYLESYAKHFSITPKFKQSVKNAEFDEVCGFWKVETQDFQYLSKWLIVATGENAEAVIPEIPGIDKFKGRLMHTSVYKSGTEFINQRVLVIGCGNSGMEVSLDLCRHNAIPHMVVRNSVHILPR

FPrintScan: PR00368
IPR013027
134-152 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

SKWLIVATGENAEAVIPEI

FPrintScan: PR00469
IPR000103
135-143 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

KWLIVATGE

FPrintScan: PR00469
IPR000103
174-198 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

FINQRVLVIGCGNSGMEVSLDLCRH

FPrintScan: PR00368
IPR013027
178-196 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

RVLVIGCGNSGMEVSLDLC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox