PRGDB00077307 (Stu.15056)

From PRG Wiki
Jump to: navigation, search
Stu.15056
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21374058 (BQ515189)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Solanum tuberosum

Comment?

EST622604 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissues Solanum tuberosum cDNA clone STMIQ63 5' end, mRNA sequence

DNA Sequence

TAACATGAATGCAAGTCATATAACAAGAACATCTGAACGAAAAAGGACATACAGAGGAGGTAAATCGCGCGTAAATGAAGCTTATGATCTTAAATAGTAATGCTAAAATTATATGGACATGGCGGAAATGTCACCTCAACAGATCCTTCAAGCATTTGACAGACCTTCCTCATAGTAGGCCTCGTAGACGGATCCTCTTGAATGCACCAAATACCAACCATCACGAACCTCTCGAGCTGCTTCTTGTCATTCAAAGCTTCGAAATCACTTTGCACTAGAGCTTCCAACTTTCCTTCTTGAAGGCAATCTAGAACCCAATCTGTAAGAATCGCCTCTGGACCGTAGCTTTCCTCATTCTCATAGTTTTTCCGACAAGTGATGATCTCTAGTAGTAGTACACCAAAGCTGTAAACGTCTACCTTAACGGTGACTTGACTATTCCTGAACCATTCTGGTGCAACATAACCTCTTGTTCCTCTAATATTAGTAAGCGTTCGACTCTGGTTAATCATCATCAGTTTAGACAATCCAAAATCTGATATTCGAGCAATGTGATGATCATCAAGGAGAATGTTTTGAGGCTTTATATCACAATGGATAATCTGTGTACTGCAC


Protein sequences

Name Description Sequence
Stu.15056 translated coding region predicted by ESTScan from UniGene Stu.15056

XCSTQIIHCDIKPQNILLDDHHIARISDFGLSKLMMINQSRTLTNIRGTRGYVAPEWFRNSQVTVKVDVYSFGVLLLEIITCRKNYENEESYGPEAILTDWVLDCLQEGKLEALVQSDFEALNDKKQLERFVMVGIWCIQEDPSTRPTMRKVCQMLEGSVEVTFPPCPYNFSITI

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-164 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XCSTQIIHCDIKPQNILLDDHHIARISDFGLSKLMMINQSRTLTNIRGTRGYVAPEWFRNSQVTVKVDVYSFGVLLLEIITCRKNYENEESYGPEAILTDWVLDCLQEGKLEALVQSDFEALNDKKQLERFVMVGIWCIQEDPSTRPTMRKVCQMLEGSVEVTF

HMMPanther: PTHR24420:SF815
2-168 RLK1 (RECEPTOR-LIKE PROTEIN KINASE 1); CARBOHYDRATE BINDING / KINASE

CSTQIIHCDIKPQNILLDDHHIARISDFGLSKLMMINQSRTLTNIRGTRGYVAPEWFRNSQVTVKVDVYSFGVLLLEIITCRKNYENEESYGPEAILTDWVLDCLQEGKLEALVQSDFEALNDKKQLERFVMVGIWCIQEDPSTRPTMRKVCQMLEGSVEVTFPPCP

HMMPanther: PTHR24420
2-168 FAMILY NOT NAMED,FAMILY NOT NAMED

CSTQIIHCDIKPQNILLDDHHIARISDFGLSKLMMINQSRTLTNIRGTRGYVAPEWFRNSQVTVKVDVYSFGVLLLEIITCRKNYENEESYGPEAILTDWVLDCLQEGKLEALVQSDFEALNDKKQLERFVMVGIWCIQEDPSTRPTMRKVCQMLEGSVEVTFPPCP

HMMSmart: SM00220
IPR002290
2-156 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

CSTQIIHCDIKPQNILLDDHHIARISDFGLSKLMMINQSRTLTNIRGTRGYVAPEWFRNSQVTVKVDVYSFGVLLLEIITCRKNYENEESYGPEAILTDWVLDCLQEGKLEALVQSDFEALNDKKQLERFVMVGIWCIQEDPSTRPTMRKVCQML

Gene3D: G3DSA:1.10.510.10
4-156 no description

TQIIHCDIKPQNILLDDHHIARISDFGLSKLMMINQSRTLTNIRGTRGYVAPEWFRNSQVTVKVDVYSFGVLLLEIITCRKNYENEESYGPEAILTDWVLDCLQEGKLEALVQSDFEALNDKKQLERFVMVGIWCIQEDPSTRPTMRKVCQML

HMMPfam: PF00069
IPR017442
4-154 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

TQIIHCDIKPQNILLDDHHIARISDFGLSKLMMINQSRTLTNIRGTRGYVAPEWFRNSQVTVKVDVYSFGVLLLEIITCRKNYENEESYGPEAILTDWVLDCLQEGKLEALVQSDFEALNDKKQLERFVMVGIWCIQEDPSTRPTMRKVCQ

superfamily: SSF56112
IPR011009
5-174 Protein kinase-like (PK-like)
Protein kinase-like domain

QIIHCDIKPQNILLDDHHIARISDFGLSKLMMINQSRTLTNIRGTRGYVAPEWFRNSQVTVKVDVYSFGVLLLEIITCRKNYENEESYGPEAILTDWVLDCLQEGKLEALVQSDFEALNDKKQLERFVMVGIWCIQEDPSTRPTMRKVCQMLEGSVEVTFPPCPYNFSIT

PatternScan: PS00108
IPR008271
6-18 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHCDIKPQNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox