PRGDB00077314 (Stu.15616)

From PRG Wiki
Jump to: navigation, search
Stu.15616
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21925662 (BQ509945)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Solanum tuberosum

Comment?

EST617360 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissues Solanum tuberosum cDNA clone STMHG48 3' end, mRNA sequence

DNA Sequence

CTGCAACAATTTGCAACTCTCTTCTGTTGTGAGGAATGGAAGAGAATAAGGATCAGTATGGTACTTCACTTGCTCACCCACTTTCTCAAGTCGAGTTGTTACTATTATTCTGCTTCTATTCCCAACGTCTGGAAAAGAAAGCCTCAAGTCATCCCATGCCATACCATCCCACATATCATCAAGGACAATGAGATATCTCCTTGCTATTAAGTTTTTCCTCAACATGTCAGCAAGATCGTCATCCTTATCTACCTTGTCTTCTAAACCGGTCACTTGACTGAAAATATCTTGCAATAGCTCTCTCCGATTATATGTTTGGGAAACAATGCACCATGCACGAACATCAAAATGTAGAACAATGTTGCCATTATTGTACACCTTTCTAGAAATTGTCGTTTTCCCTTGTCCCCCCATGCCTACAATTGGGACGACGTCTAGCTCATTTTTATCGCTAATCAGATACTGAATCATTTTTTCTGTGACATTCCCAAAACCCATTATCTCCTCATCAGCCACTGGATTGCTATGTTGAGTTGACAGATGTTTAGATGGAGCTATCACATAATGAGGCTCAAGAGCAACGTCCATTGACCACATCTCAGTCACCTCTGCATTAATTTGCTTGATCTCTTTTAAGATTTTTGGAAGTGAGCaaaaaatatgcaaaaaaaCATTATACTGAGCAAGAATACTGTCAATGGAAACTTCGACTTCATATGCCAATTGGATGGTAAGTCTCTGAAGATTTTTAAGAATTATATGTTCACTGTGCACCTTTGCAACATCTCTGAAAATGGATGATAAAGATGACAACTCCTTCTCTAAAATGGATGTAAGAGCTGATATCTCTTTCTCCAAATACCTAAGAGAGGTTTCATTAAGAAATCTAAACAGAATTAGATTTCGACATCTCATTCAGTTTCCTTAAAGAGAATCCAGCCCATTTCACCAAGGTGGGAGCTGAGATGGAGTAATTTT


Protein sequences

Name Description Sequence
Stu.15616 translated coding region predicted by ESTScan from UniGene Stu.15616

XNYSISAPTLVKWAGFSLRKLNEMSKSILFRFLNETSLRYLEKEISALTSILEKELSSLSSIFRDVAKVHSEHIILKNLQRLTIQLAYEVEVSIDSILAQYNVFLHIFCSLPKILKEIKQINAEVTEMWSMDVALEPHYVIAPSKHLSTQHSNPVADEEIMGFGNVTEKMIQYLISDKNELDVVPIVGMGGQGKTTISRKVYNNGNIVLHFDVRAWCIVSQTYNRRELLQDIFSQVTGLEDKVDKDDDLADMLRKNLIARRYLIVLDDMWDGMAWDDLRLSFPDVGNRSRIIVTTRLEKVGEQVKYHTDPYSLPFLTTEESCKLLQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
10-292 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LVKWAGFSLRKLNEMSKSILFRFLNETSLRYLEKEISALTSILEKELSSLSSIFRDVAKVHSEHIILKNLQRLTIQLAYEVEVSIDSILAQYNVFLHIFCSLPKILKEIKQINAEVTEMWSMDVALEPHYVIAPSKHLSTQHSNPVADEEIMGFGNVTEKMIQYLISDKNELDVVPIVGMGGQGKTTISRKVYNNGNIVLHFDVRAWCIVSQTYNRRELLQDIFSQVTGLEDKVDKDDDLADMLRKNLIARRYLIVLDDMWDGMAWDDLRLSFPDVGNRSRII

HMMPanther: PTHR23155
10-292 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LVKWAGFSLRKLNEMSKSILFRFLNETSLRYLEKEISALTSILEKELSSLSSIFRDVAKVHSEHIILKNLQRLTIQLAYEVEVSIDSILAQYNVFLHIFCSLPKILKEIKQINAEVTEMWSMDVALEPHYVIAPSKHLSTQHSNPVADEEIMGFGNVTEKMIQYLISDKNELDVVPIVGMGGQGKTTISRKVYNNGNIVLHFDVRAWCIVSQTYNRRELLQDIFSQVTGLEDKVDKDDDLADMLRKNLIARRYLIVLDDMWDGMAWDDLRLSFPDVGNRSRII

Seg: seg
48-62 seg

LTSILEKELSSLSSI

superfamily: SSF52540
140-326 P-loop containing nucleoside triphosphate hydrolases

VIAPSKHLSTQHSNPVADEEIMGFGNVTEKMIQYLISDKNELDVVPIVGMGGQGKTTISRKVYNNGNIVLHFDVRAWCIVSQTYNRRELLQDIFSQVTGLEDKVDKDDDLADMLRKNLIARRYLIVLDDMWDGMAWDDLRLSFPDVGNRSRIIVTTRLEKVGEQVKYHTDPYSLPFLTTEESCKLLQ

HMMPfam: PF00931
IPR002182
167-326 NB-ARC,NBS
NB-ARC

TEKMIQYLISDKNELDVVPIVGMGGQGKTTISRKVYNNGNIVLHFDVRAWCIVSQTYNRRELLQDIFSQVTGLEDKVDKDDDLADMLRKNLIARRYLIVLDDMWDGMAWDDLRLSFPDVGNRSRIIVTTRLEKVGEQVKYHTDPYSLPFLTTEESCKLLQ

FPrintScan: PR00364
IPR000767
183-198 DISEASERSIST
Disease resistance protein

VVPIVGMGGQGKTTIS

Seg: seg
239-255 seg

LEDKVDKDDDLADMLRK

FPrintScan: PR00364
IPR000767
256-270 DISEASERSIST
Disease resistance protein

NLIARRYLIVLDDMW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox