PRGDB00077347 (Stu.18127)

From PRG Wiki
Jump to: navigation, search
Stu.18127
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21915068 (BQ111670)
Gene Class Unknown
Domain Type LRR
Gene Species Solanum tuberosum

Comment?

EST597246 mixed potato tissues Solanum tuberosum cDNA clone STMCC32 5' end, mRNA sequence

DNA Sequence

GGGATGTGGGTAATGAAGTATGGAACAAATTATACTTGAGGTCTTTTTTCCAAGAGATTGAAGTTAAATCTGGCAAAACTTATTTCAAGATGCATGATCTCATCCATGATTTGGCTACATCTCTGTTTTTGGCAAGAGCATCAAGCAGCAATATCCGTGAAATAAATGTAAACGAGTACTTACATATGATGTCCATTGGTTTTGCTAAAGTGGAGTCTTCCTACTCTCATTTGCTCTTGGAGAACTTTGTCTCGTTGAGGGTGCTTACTCTGAATTTCTTAAAACTCAATCAGTTACCGTCTTCCATTGGAGATCTAGTACATTTAAGATACCTGGACCTCTCTTACAATACAGAAATGCGTAGTCTTCCAAAGCAGTTATGCAAGCTTCAAAATCTGCAGACTCTTGATCTACAGTATTGCACCTCACTTTGTTGTTTGCCAAAAGAAACAAGTAAACTTGGTAGTCTCCGAAATCTTTTACTTGATGGTTGCCGTGGATTGACTTGTATGCCACCAAGGATAGGATCATTGACATGCCTTAAGACTCTAAGTTGCTTTGTTGTGGGAAGGAAGAAAGGTTTTCAACTTGGGGAACTAGGAAACCTGAATCTGTAT


Protein sequences

Name Description Sequence
Stu.18127 translated coding region predicted by ESTScan from UniGene Stu.18127

XDVGNEVWNKLYLRSFFQEIEVKSGKTYFKMHDLIHDLATSLFLARASSSNIREINVNEYLHMMSIGFAKVESSYSHLLLENFVSLRVLTLNFLKLNQLPSSIGDLVHLRYLDLSYNTEMRSLPKQLCKLQNLQTLDLQYCTSLCCLPKETSKLGSLRNLLLDGCRGLTCMPPRIGSLTCLKTLSCFVVGRKKGFQLGELGNLNLY

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
30-203 L domain-like,LRR

KMHDLIHDLATSLFLARASSSNIREINVNEYLHMMSIGFAKVESSYSHLLLENFVSLRVLTLNFLKLNQLPSSIGDLVHLRYLDLSYNTEMRSLPKQLCKLQNLQTLDLQYCTSLCCLPKETSKLGSLRNLLLDGCRGLTCMPPRIGSLTCLKTLSCFVVGRKKGFQLGELGNL

HMMPanther: PTHR23155:SF121
46-184 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RASSSNIREINVNEYLHMMSIGFAKVESSYSHLLLENFVSLRVLTLNFLKLNQLPSSIGDLVHLRYLDLSYNTEMRSLPKQLCKLQNLQTLDLQYCTSLCCLPKETSKLGSLRNLLLDGCRGLTCMPPRIGSLTCLKTL

HMMPanther: PTHR23155
46-184 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RASSSNIREINVNEYLHMMSIGFAKVESSYSHLLLENFVSLRVLTLNFLKLNQLPSSIGDLVHLRYLDLSYNTEMRSLPKQLCKLQNLQTLDLQYCTSLCCLPKETSKLGSLRNLLLDGCRGLTCMPPRIGSLTCLKTL

Gene3D: G3DSA:3.80.10.10
80-185 no description

LENFVSLRVLTLNFLKLNQLPSSIGDLVHLRYLDLSYNTEMRSLPKQLCKLQNLQTLDLQYCTSLCCLPKETSKLGSLRNLLLDGCRGLTCMPPRIGSLTCLKTLS

HMMPfam: PF13855
108-166 LRR_8,Leucine rich repeat

HLRYLDLSYNTEMRSLPKQLCKLQNLQTLDLQYCTSLCCLPKETSKLGSLRNLLLDGCR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox