PRGDB00077350 (Stu.18317)

From PRG Wiki
Jump to: navigation, search
Stu.18317
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 3947732 (AJ009719)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum mRNA for NL25 protein

DNA Sequence

GTAATTTCTCTGAAttttttttAGTTTTATCTCATTCTATCGTTATTGTTAATCGTTACTCCCTCTATAACTTTATTTTTCTTGTTAGACAATTAACCGAATCCATGGcttcttcttcttcttcttcttATGCGAGTGATTCACAAAACTGTACTCATTGGAAGTACCATGTCTTTCTAAGTTTTAGAGGTGACGATACCCGTAAAACATTTACAAGTCACTTGTTTGAAGGTTTGAAACACAGGGGAATATTCACCTTTCAAGATGATAAAAGGCTAGAGAAAGGTGATTCCATCCCAGAAGAACTCTTGAAAGCTATCGAAGAGTCTCAAGTTGCTCTTGTCATTTTCTCAAAGAATTATGCTACATCTAGGTGGTGCTTGAACGAACTAGTAAAGATCATGGAATGCAAGGAAGTAAAGAAACAAATAGTCATGCCAGTCTTCTATGATGTGGATCCATCAGACGTTCGACACCAAACAGGGAGCTTTGCAGAAGCCTTTTCCAAACACAAATCGAGGTATAAGGATGATGTTGATGGGATGCAGATGGTTCAAGGATGGAGAACTGCCCTAAGTGCTGCCGCTGATCTAAGCGGTACAAATGTTCCTGGCAGGATTGAATCAGAATGTATTCGAGAACTTGTTGACGCTGTTTCTTCCAAACTTTGCAAGACTTCTTCATCTTCATCAGAATATACTGTGGGAATAGATACTCATCTGAAGGAAGTAAAATCCCTGCTAGAGATGGAATCTGGTGATGTTCGGATTTTGGGGATCTGGGGAATGGGGGGAGTCGGTAAAACGACTCTAGCAAGAGCTGTTTTTGATACACTCTCACCTCGATTTCAATATGCAAGTTTCCTTGAGAATGTCAAAGAAACTAACATAAATGAAATACAAAATAAACTTCTCTCTGAACTATTAAGGGAAGACAAAAAACATGTAGATAATAAGACGGAAGGGAAGCGTCTGATGGCTAAAAGACTTCGTTTTATGAAGGTTTTAATTGTGCTTGATGACATCAATCATTGTGATCATTTGGAGTATTTAGCAGGGGATCTTTGTTGGTTTGGCAGTGGAAGTAGAATTATTGCAACAACTAGAAATAGGGAAATTTTAGGGATGAATAATGTAGTACATCAAGTGACTACACTACTCGAACCTGATGCTATTCAGTTGTTCAATCATTATGCTTTCAAGGGATTATTCAGTCCAGATGAGCATATGAAGAAGTTGGCTCTAGAGGCAGTCAGTCATGCTAAAGGTCTTCCTTTAGCGTTGAAATTGTGGGGGATTTGGTTAAATAATAAAGATAAAACTCTGTGGAGAGAAGCTGTAGACATGATACGGAGAGAATCTAGTGAAGATGTTGTTAATAACCTCAAAATAAGTTTTGAAGGGTTGCAAGATAAAGAGAAAACAATATTTCTAGATATTGCATGCTTCTTTAGAGGGATGAGGAAAGATAAAACCATTGAAATTCTTAAGAGCTATGATTTGGACGCTCATATCAGATTGCATGGTATAATAGAGAAATCTCTTGTGTCCATCTCTGAATATGAAACACTTCAAATGCATGACTTAATTCAAGACATGGGTAGATATGTAGTGAAAGAGCAAAAAGGTTCCAGAAGCAGAGTATGGAATGTTGAGGATTTTGAAGATGTGATGATGGACAGTATGGGACAAGGGAAATGGAAGTAATATGGTTATGGACATCTAAAAAACTAAGCTTTAGCAAAGAGGAAATGAAAAATATGCAAAGGCTTAGGATATTATACATACGGCCTTATCCAGTGGTTTCCCTAATTGATTCAGAAGATGGCTCTATTGAGTACTTGCCCAAACAACTTGCGTTGGTTTGTGTGGCATGAATATCCTTGGAAGTTTTTGCCAGATAATTTTAATCCCAAAAGGCTTGTTAATCTTGATCTCCAACGTAGTTCATTGCATTATTTATGGAAGAAAACAGAGGTACCATTCTATTTTCAGATACTTTCTATTTTTAATTGTCCTAGAATTATAATTGTTCTCATATT


Protein sequences

Name Description Sequence
Stu.18317 translated coding region predicted by ESTScan from UniGene Stu.18317

MASSSSSSYASDSQNCTHWKYHVFLSFRGDDTRKTFTSHLFEGLKHRGIFTFQDDKRLEKGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEVKKQIVMPVFYDVDPSDVRHQTGSFAEAFSKHKSRYKDDVDGMQMVQGWRTALSAAADLSGTNVPGRIESECIRELVDAVSSKLCKTSSSSSEYTVGIDTHLKEVKSLLEMESGDVRILGIWGMGGVGKTTLARAVFDTLSPRFQYASFLENVKETNINEIQNKLLSELLREDKKHVDNKTEGKRLMAKRLRFMKVLIVLDDINHCDHLEYLAGDLCWFGSGSRIIATTRNREILGMNNVVHQVTTLLEPDAIQLFNHYAFKGLFSPDEHMKKLALEAVSHAKGLPLALKLWGIWLNNKDKTLWREAVDMIRRESSEDVVNNLKISFEGLQDKEKTIFLDIACFFRGMRKDKTIEILKSYDLDAHIRLHGIIEKSLVSISEYETLQMHDLIQDMGRYVVKEQKGSRSRVWNVEDFEDVMMDSMGQGKWK

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
9-166 TIR
Toll-Interleukin receptor

YASDSQNCTHWKYHVFLSFRGDDTRKTFTSHLFEGLKHRGIFTFQDDKRLEKGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEVKKQIVMPVFYDVDPSDVRHQTGSFAEAFSKHKSRYKDDVDGMQMVQGWRTALSAAADLSGT

Gene3D: G3DSA:3.40.50.10140
18-139 G3DSA:3.40.50.10140

HWKYHVFLSFRGDDTRKTFTSHLFEGLKHRGIFTFQDDKRLEKGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEVKKQIVMPVFYDVDPSDVRHQTGSFAEAFSKHKSR

ProfileScan: PS50104
IPR000157
19-163 TIR
Toll-Interleukin receptor

WKYHVFLSFRGDDTRKTFTSHLFEGLKHRGIFTFQDDKRLEKGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEVKKQIVMPVFYDVDPSDVRHQTGSFAEAFSKHKSRYKDDVDGMQMVQGWRTALSAAADL

HMMSmart: SM00255
IPR000157
20-163 TIR
Toll-Interleukin receptor

KYHVFLSFRGDDTRKTFTSHLFEGLKHRGIFTFQDDKRLEKGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEVKKQIVMPVFYDVDPSDVRHQTGSFAEAFSKHKSRYKDDVDGMQMVQGWRTALSAAADL

HMMPfam: PF01582
IPR000157
23-158 TIR
Toll-Interleukin receptor

VFLSFRGDDTRKTFTSHLFEGLKHRGIFTFQDDKRLEKGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEVKKQIVMPVFYDVDPSDVRHQTGSFAEAFSKHKSRYKDDVDGMQMVQGWRTALS

HMMPanther: PTHR11017:SF20
48-531 PTHR11017:SF20,SUBFAMILY NOT NAMED

GIFTFQDDKRLEKGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEVKKQIVMPVFYDVDPSDVRHQTGSFAEAFSKHKSRYKDDVDGMQMVQGWRTALSAAADLSGTNVPGRIESECIRELVDAVSSKLCKTSSSSSEYTVGIDTHLKEVKSLLEMESGDVRILGIWGMGGVGKTTLARAVFDTLSPRFQYASFLENVKETNINEIQNKLLSELLREDKKHVDNKTEGKRLMAKRLRFMKVLIVLDDINHCDHLEYLAGDLCWFGSGSRIIATTRNREILGMNNVVHQVTTLLEPDAIQLFNHYAFKGLFSPDEHMKKLALEAVSHAKGLPLALKLWGIWLNNKDKTLWREAVDMIRRESSEDVVNNLKISFEGLQDKEKTIFLDIACFFRGMRKDKTIEILKSYDLDAHIRLHGIIEKSLVSISEYETLQMHDLIQDMGRYVVKEQKGSRSRVWNVEDFEDVMMDSMGQGK

HMMPanther: PTHR11017
48-531 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GIFTFQDDKRLEKGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEVKKQIVMPVFYDVDPSDVRHQTGSFAEAFSKHKSRYKDDVDGMQMVQGWRTALSAAADLSGTNVPGRIESECIRELVDAVSSKLCKTSSSSSEYTVGIDTHLKEVKSLLEMESGDVRILGIWGMGGVGKTTLARAVFDTLSPRFQYASFLENVKETNINEIQNKLLSELLREDKKHVDNKTEGKRLMAKRLRFMKVLIVLDDINHCDHLEYLAGDLCWFGSGSRIIATTRNREILGMNNVVHQVTTLLEPDAIQLFNHYAFKGLFSPDEHMKKLALEAVSHAKGLPLALKLWGIWLNNKDKTLWREAVDMIRRESSEDVVNNLKISFEGLQDKEKTIFLDIACFFRGMRKDKTIEILKSYDLDAHIRLHGIIEKSLVSISEYETLQMHDLIQDMGRYVVKEQKGSRSRVWNVEDFEDVMMDSMGQGK

superfamily: SSF52540
182-423 SSF52540

DAVSSKLCKTSSSSSEYTVGIDTHLKEVKSLLEMESGDVRILGIWGMGGVGKTTLARAVFDTLSPRFQYASFLENVKETNINEIQNKLLSELLREDKKHVDNKTEGKRLMAKRLRFMKVLIVLDDINHCDHLEYLAGDLCWFGSGSRIIATTRNREILGMNNVVHQVTTLLEPDAIQLFNHYAFKGLFSPDEHMKKLALEAVSHAKGLPLALKLWGIWLNNKDKTLWREAVDMIRRESSEDV

Gene3D: G3DSA:3.40.50.300
203-309 G3DSA:3.40.50.300

DTHLKEVKSLLEMESGDVRILGIWGMGGVGKTTLARAVFDTLSPRFQYASFLENVKETNINEIQNKLLSELLREDKKHVDNKTEGKRLMAKRLRFMKVLIVLDDINH

HMMPfam: PF00931
IPR002182
203-459 NB-ARC,NBS
NB-ARC

DTHLKEVKSLLEMESGDVRILGIWGMGGVGKTTLARAVFDTLSPRFQYASFLENVKETNINEIQNKLLSELLREDKKHVDNKTEGKRLMAKRLRFMKVLIVLDDINHCDHLEYLAGDLCWFGSGSRIIATTRNREILGMNNVVHQVTTLLEPDAIQLFNHYAFKGLFSPDEHMKKLALEAVSHAKGLPLALKLWGIWLNNKDKTLWREAVDMIRRESSEDVVNNLKISFEGLQDKEKTIFLDIACFFRGMRKDKTIE

FPrintScan: PR00364
IPR000767
222-237 DISEASERSIST
Disease resistance protein

ILGIWGMGGVGKTTLA

FPrintScan: PR00364
IPR000767
294-308 DISEASERSIST
Disease resistance protein

RLRFMKVLIVLDDIN

FPrintScan: PR00364
IPR000767
386-400 DISEASERSIST
Disease resistance protein

AKGLPLALKLWGIWL

superfamily: SSF46785
421-524 SSF46785

EDVVNNLKISFEGLQDKEKTIFLDIACFFRGMRKDKTIEILKSYDLDAHIRLHGIIEKSLVSISEYETLQMHDLIQDMGRYVVKEQKGSRSRVWNVEDFEDVMM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox