PRGDB00077367 (Stu.19680)

From PRG Wiki
Jump to: navigation, search
Stu.19680
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 62952148 (DN941877)
Gene Class N
Domain Type NBS
Gene Species Solanum tuberosum

Comment?

3432.2 Tuber Skin Solanum tuberosum cDNA clone 3432 5', mRNA sequence

DNA Sequence

GGCCACGGAGTTCCACCGGCGATCCCGTCGCCGGAGAAAACTTGTTCACGAACACAAAATTCCTCCTGAACAATATCTCCGGCGAGGCCCGGGACGGCGAGATAGTCGCCGTCCTGGGTGCATCAGGGTCGGGAAAATCGACCCTGATCGATGCCCTTGCGAATAGGATCGCGAAGGAGAGTTTAAAAGGAATGATAACGTTGAACGGAGAGCCACTCGATTCGAGATTGTTGAAAGTAATCTCAGCATATGTAATGCAAGATGATCTTTTATATCCAATGTTGACAGTTGAAGAAACGTTAATGTTTGCAGCTGAATTCAGATTGCCACGTACTTTGTcaaaatcaaaaaagaaaaTGAGAGTTCAAGCTTTGATTGATCAATTAGGACTACGAAATGCTGCAAAAACAATCATTGGTGATGAGGGTCATCGTGGAGTGTCTGGTGGTGAAAGACGACGAGTTTCTATTGGAATTGACCTTATACATGACCCTATCATATGGTTTTTAGACGAACCAACCTCAGGTCTTGATTCGACTAGTGCATACATGGTGGTGAAAGTCCTTCAACGAATTGCTCAAAGTGGAAGTATCGTGATCATGTCAATCCATCAGCCAAGTTATCGAATCCTCGGGTNATCGGATCGGATGGCTCTCCTTGTCCCGTGGTCAAACGGTTTATAGCGGGTCACCTATGAACCTCCCACATTTTTTTGCTGATTTGGGTCACCCAATTCCAGATAGTGAAAATCGAACAGAGTTTGCTCTGGAATCTGATTCGA


Protein sequences

Name Description Sequence
Stu.19680 translated coding region predicted by ESTScan from UniGene Stu.19680

XPRSSTGDPVAGENLFTNTKFLLNNISGEARDGEIVAVLGASGSGKSTLIDALANRIAKESLKGMITLNGEPLDSRLLKVISAYVMQDDLLYPMLTVEETLMFAAEFRLPRTLSKSKKKMRVQALIDQLGLRNAAKTIIGDEGHRGVSGGERRRVSIGIDLIHDPIIWFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSTISQVIESSGXRIGWLSLSRGQTVYSGSPMNLPHFFADLGHPIPDSENRTEFALESDSX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50893
IPR003439
4-247 ABC_TRANSPORTER_2
ABC transporter-like

SSTGDPVAGENLFTNTKFLLNNISGEARDGEIVAVLGASGSGKSTLIDALANRIAKESLKGMITLNGEPLDSRLLKVISAYVMQDDLLYPMLTVEETLMFAAEFRLPRTLSKSKKKMRVQALIDQLGLRNAAKTIIGDEGHRGVSGGERRRVSIGIDLIHDPIIWFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSTISQVIESSGXRIGWLSLSRGQTVYSGSPMNLPHFFADLGHPIPD

Seg: seg
14-25 seg

NLFTNTKFLLNN

HMMPanther: PTHR19241:SF102
17-256 SUBFAMILY NOT NAMED

TNTKFLLNNISGEARDGEIVAVLGASGSGKSTLIDALANRIAKESLKGMITLNGEPLDSRLLKVISAYVMQDDLLYPMLTVEETLMFAAEFRLPRTLSKSKKKMRVQALIDQLGLRNAAKTIIGDEGHRGVSGGERRRVSIGIDLIHDPIIWFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSTISQVIESSGXRIGWLSLSRGQTVYSGSPMNLPHFFADLGHPIPDSENRTEFAL

HMMPanther: PTHR19241
17-256 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

TNTKFLLNNISGEARDGEIVAVLGASGSGKSTLIDALANRIAKESLKGMITLNGEPLDSRLLKVISAYVMQDDLLYPMLTVEETLMFAAEFRLPRTLSKSKKKMRVQALIDQLGLRNAAKTIIGDEGHRGVSGGERRRVSIGIDLIHDPIIWFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSTISQVIESSGXRIGWLSLSRGQTVYSGSPMNLPHFFADLGHPIPDSENRTEFAL

superfamily: SSF52540
18-251 P-loop containing nucleoside triphosphate hydrolases

NTKFLLNNISGEARDGEIVAVLGASGSGKSTLIDALANRIAKESLKGMITLNGEPLDSRLLKVISAYVMQDDLLYPMLTVEETLMFAAEFRLPRTLSKSKKKMRVQALIDQLGLRNAAKTIIGDEGHRGVSGGERRRVSIGIDLIHDPIIWFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSTISQVIESSGXRIGWLSLSRGQTVYSGSPMNLPHFFADLGHPIPDSENR

Gene3D: G3DSA:3.40.50.300
20-234 no description

KFLLNNISGEARDGEIVAVLGASGSGKSTLIDALANRIAKESLKGMITLNGEPLDSRLLKVISAYVMQDDLLYPMLTVEETLMFAAEFRLPRTLSKSKKKMRVQALIDQLGLRNAAKTIIGDEGHRGVSGGERRRVSIGIDLIHDPIIWFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSTISQVIESSGXRIGWLSLSRGQTVYSGSPMNL

HMMSmart: SM00382
IPR003593
32-212 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

DGEIVAVLGASGSGKSTLIDALANRIAKESLKGMITLNGEPLDSRLLKVISAYVMQDDLLYPMLTVEETLMFAAEFRLPRTLSKSKKKMRVQALIDQLGLRNAAKTIIGDEGHRGVSGGERRRVSIGIDLIHDPIIWFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSTISQVIESSG

HMMPfam: PF00005
IPR003439
47-175 ABC_tran
ABC transporter-like

STLIDALANRIAKESLKGMITLNGEPLDSRLLKVISAYVMQDDLLYPMLTVEETLMFAAEFRLPRTLSKSKKKMRVQALIDQLGLRNAAKTIIGDEGHRGVSGGERRRVSIGIDLIHDPIIWFLDEPTS

Seg: seg
142-159 seg

EGHRGVSGGERRRVSIGI

PatternScan: PS00211
IPR017871
147-161 ABC_TRANSPORTER_1
ABC transporter, conserved site

VSGGERRRVSIGIDL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox