PRGDB00077370 (Stu.19955)

From PRG Wiki
Jump to: navigation, search
Stu.19955
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 119866044 (EF137705)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum Tm-2 ToMV resistance protein mRNA, complete cds

DNA Sequence

ATGGCTGAAATTCTTCTCACAGCAGTCATCAATAAATCAATAGAAATAGCTGGAAATCTACTCTTTCAAGAAGGGAGCCGCTTGAATTTTTTGAAAGAGGACATCGATTGGCTCCAGAGAGTACTGAGACACATTCGATCATATGTAGACGATGCAAAGGCCAAGGAAGTTGGAGGCGATTCAAAGGTGAAAAACTTATTAAAAGATATTCAAGAATTGGCAGGTGATGTGGAGGATCTCTTAGATGACTTCCTTCCAAAAATTCAACAATCCAATAAGTTCATTTGTTTCCTTAAGACGGCCTGCATCCCTTGTGCCAATGAGTTTGCTATGGAGATTGAGAAGATAAGAAGAAGGGTTGCTGACATTGATAGGTTAAGGACAACTTTCAACATCACAGATACAAGTAACAACAATAATGATTGCATTCCAATGGAACAGAGAAGAAAATTCCTTCGTGCTGATGAAACAGAGGTCATCGGTTTGGATGATGCCTTCAATACACTACAAGCCAAATTACTTGATCAAGATTTGCCTTATGGAGTTGTTTCAATAGTTGGCATGCCCGGTTTGGGGAAAACAACTCTTGCCAAGAAACTTTATAGGCATGTCCGTCATCAATTTGAGAGCTCGGGACTGGTCTATGTTTCACAACAGCCAAGGGCGGGAGAAATCTTACATGACATAGCCAAACAAGTTGGACTGCCagaagaagaaagaaaagaaaaCTTGGAGAACAACCTACGATCACTCTTGAAAATAAAAAGGTATGTTATTCTCTTAGATGACATTTGGGATGTTGAAATTTGGGATCATCTAAAACTTGTCCTTCCTGAACGTGATTCAAAAATTGGCAGTAGGATAATTATAACCTCTCGAAATAGTAATGTAGGCAGATACATAGGAGGGGATTTCTCAATCCACGTGTTGCAACCTCTAGATTCAGAGAACAGTTTTGAACTCTTTACCAAGAAAATCTTTACTTTTGATAACAATAATAATTGGGACAGTGCTTCACCAGACTGGGTAGATATTGGTAGAAGTATAGTTGGGAGATGTGGAGGTATACCTCTAGCCATTGTGGTGACCGCAGGCATCTTAAGGGCAAGAGAAAGAACAGAACGTGCATGGAACAGAGTACTTGATAGTATGGGCCATAAAGTTCAAGATGGATGTGCTAAGGTATTGGCTCTGAGTTATAATGATTTGCCCATTGCATTAAGGCCATGTTTCTTGTACTTTGGCCTTTACCCTGAGGACCATGAAATTCATGCTTTTGATTTGACAAATATGTGGATTGCTGAGAAGTTGATAGTTGTAAATAGTGGTAATATGCGAGAGGCTGAAGATTTGGTGGAGGATGTCCTTAATGATTTGGTTTCTAGAAACTTGATTCAAGTTGCCAAATGGAAATATAATGGAAGAATTTCAAGTTGTCGCATACATGACATGTTACATAGTTTGTGTGTGGACTTGGCTGAGGAAAGTAACTTCTTTCACACTGAGTACAATGCATTTGGTGATCTCCGCAATGTTGCTAGGGTGCGAAGGATTACATTCTACTCTGATAATGTAATGAATGAGTTCTTTCGTTCAAATCCTAATCCGAAGAAGCTTCTTGCACTTTTCTGTTTCACAAAAGACCGTTGCATATTTGCTCAGTTGGCTCATCTTGACTTCAAATTATTGCAAGTGTTGGTTGTAGTTATGTCTCAAGATGGTTATGGGGGCTTCACTATGGGAAACAAATTTGGGAAGATGAGTTGCTTACGCTATCTGCGATTGGAGGGGGTAATTAGAGGAAAATTGCTAAATAATATTGTGAAGCTCAAATGTCTAGAGACCATAGGTATTGGAGTGGGCGACATTGAACTTCCTTGTAGTGTTTGGGATTTTAAACAATTGAGACATGTTCATTGTAGAGAAGAACTTAAGGGTTTCTTTTCTAATAAGCCCAAACATGTGGCTCATGATAATCTACAAACTTTGATGTGGATGGATGATAATTTTTTTGAGGCGAGATTGTTGCACCAATTGATAAATTTAAGAAAACTGGGTATAAGTTCAGCATCTAATTCTACCATCAAGATATTATCAGGATTGAGCCCTGTGCCAAAGACGTTGGAGGTTCTGAAGCTCAAATTTTGCAATGAATCGAGTGAGCAAATAAACTTGTCGTCGTATCTAAATATTGTTAAGTTGCATTTGAACGCAGCAATGCGCTTGACCTGTGAAGCATTCCCTCCAAATCTGGTCAAGCTTACTCTTGTCTACTTGACGGTAGACGATCATGTAGTGGCAGAGCTTAAGAAATTGCCCAAATTAAGAATACTTAAAATGGTTGGCTGTGAACATAAAAAAGAAGAGATGGATCTCTCTGGTGATGGCTTTCCGCAACTTGAAGTTTTGCATATTCAAAATCCACTCTGGTTGCCTGAAATAACATGCACGGATGATGTCAGTATGCCTAAACTTAAAAAGTTATTACTTACAGGAGTTTATTCCCAGATTAGGCTCTCGGAACGTCTTGTAAAGCTGAGAGTATGAAAATCTCAATGCGTCAACAGATGCATATCAGAATGATTTAAGTCTTTGGTGGAGACCATCTTCTGATGCCTGTTTGTATTAATTGTAATAAATAAATGAAATGTTTGATTGCTTTTTCAAGTTGATGTATTTGTGGCTTGTGATTTGTAAAAGATATCTATTTATTGTCTT


Protein sequences

Name Description Sequence
Stu.19955 translated coding region predicted by ESTScan from UniGene Stu.19955

MAEILLTAVINKSIEIAGNLLFQEGSRLNFLKEDIDWLQRVLRHIRSYVDDAKAKEVGGDSKVKNLLKDIQELAGDVEDLLDDFLPKIQQSNKFICFLKTACIPCANEFAMEIEKIRRRVADIDRLRTTFNITDTSNNNNDCIPMEQRRKFLRADETEVIGLDDAFNTLQAKLLDQDLPYGVVSIVGMPGLGKTTLAKKLYRHVRHQFESSGLVYVSQQPRAGEILHDIAKQVGLPEEERKENLENNLRSLLKIKRYVILLDDIWDVEIWDHLKLVLPERDSKIGSRIIITSRNSNVGRYIGGDFSIHVLQPLDSENSFELFTKKIFTFDNNNNWDSASPDWVDIGRSIVGRCGGIPLAIVVTAGILRARERTERAWNRVLDSMGHKVQDGCAKVLALSYNDLPIALRPCFLYFGLYPEDHEIHAFDLTNMWIAEKLIVVNSGNMREAEDLVEDVLNDLVSRNLIQVAKWKYNGRISSCRIHDMLHSLCVDLAEESNFFHTEYNAFGDLRNVARVRRITFYSDNVMNEFFRSNPNPKKLLALFCFTKDRCIFAQLAHLDFKLLQVLVVVMSQDGYGGFTMGNKFGKMSCLRYLRLEGVIRGKLLNNIVKLKCLETIGIGVGDIELPCSVWDFKQLRHVHCREELKGFFSNKPKHVAHDNLQTLMWMDDNFFEARLLHQLINLRKLGISSASNSTIKILSGLSPVPKTLEVLKLKFCNESSEQINLSSYLNIVKLHLNAAMRLTCEAFPPNLVKLTLVYLTVDDHVVAELKKLPKLRILKMVGCEHKKEEMDLSGDGFPQLEVLHIQNPLWLPEITCTDDVSMPKLKKLLLTGVYSQIRLSERLVKLRV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF126
8-498 PTHR11017:SF126,OS11G0237600 PROTEIN

AVINKSIEIAGNLLFQEGSRLNFLKEDIDWLQRVLRHIRSYVDDAKAKEVGGDSKVKNLLKDIQELAGDVEDLLDDFLPKIQQSNKFICFLKTACIPCANEFAMEIEKIRRRVADIDRLRTTFNITDTSNNNNDCIPMEQRRKFLRADETEVIGLDDAFNTLQAKLLDQDLPYGVVSIVGMPGLGKTTLAKKLYRHVRHQFESSGLVYVSQQPRAGEILHDIAKQVGLPEEERKENLENNLRSLLKIKRYVILLDDIWDVEIWDHLKLVLPERDSKIGSRIIITSRNSNVGRYIGGDFSIHVLQPLDSENSFELFTKKIFTFDNNNNWDSASPDWVDIGRSIVGRCGGIPLAIVVTAGILRARERTERAWNRVLDSMGHKVQDGCAKVLALSYNDLPIALRPCFLYFGLYPEDHEIHAFDLTNMWIAEKLIVVNSGNMREAEDLVEDVLNDLVSRNLIQVAKWKYNGRISSCRIHDMLHSLCVDLAEESNF

HMMPanther: PTHR11017
8-498 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AVINKSIEIAGNLLFQEGSRLNFLKEDIDWLQRVLRHIRSYVDDAKAKEVGGDSKVKNLLKDIQELAGDVEDLLDDFLPKIQQSNKFICFLKTACIPCANEFAMEIEKIRRRVADIDRLRTTFNITDTSNNNNDCIPMEQRRKFLRADETEVIGLDDAFNTLQAKLLDQDLPYGVVSIVGMPGLGKTTLAKKLYRHVRHQFESSGLVYVSQQPRAGEILHDIAKQVGLPEEERKENLENNLRSLLKIKRYVILLDDIWDVEIWDHLKLVLPERDSKIGSRIIITSRNSNVGRYIGGDFSIHVLQPLDSENSFELFTKKIFTFDNNNNWDSASPDWVDIGRSIVGRCGGIPLAIVVTAGILRARERTERAWNRVLDSMGHKVQDGCAKVLALSYNDLPIALRPCFLYFGLYPEDHEIHAFDLTNMWIAEKLIVVNSGNMREAEDLVEDVLNDLVSRNLIQVAKWKYNGRISSCRIHDMLHSLCVDLAEESNF

superfamily: SSF52540
142-392 SSF52540

CIPMEQRRKFLRADETEVIGLDDAFNTLQAKLLDQDLPYGVVSIVGMPGLGKTTLAKKLYRHVRHQFESSGLVYVSQQPRAGEILHDIAKQVGLPEEERKENLENNLRSLLKIKRYVILLDDIWDVEIWDHLKLVLPERDSKIGSRIIITSRNSNVGRYIGGDFSIHVLQPLDSENSFELFTKKIFTFDNNNNWDSASPDWVDIGRSIVGRCGGIPLAIVVTAGILRARERTERAWNRVLDSMGHKVQDGC

HMMPfam: PF00931
IPR002182
164-440 NB-ARC,NBS
NB-ARC

DAFNTLQAKLLDQDLPYGVVSIVGMPGLGKTTLAKKLYRHVRHQFESSGLVYVSQQPRAGEILHDIAKQVGLPEEERKENLENNLRSLLKIKRYVILLDDIWDVEIWDHLKLVLPERDSKIGSRIIITSRNSNVGRYIGGDFSIHVLQPLDSENSFELFTKKIFTFDNNNNWDSASPDWVDIGRSIVGRCGGIPLAIVVTAGILRARERTERAWNRVLDSMGHKVQDGCAKVLALSYNDLPIALRPCFLYFGLYPEDHEIHAFDLTNMWIAEKLIVV

Gene3D: G3DSA:3.40.50.300
168-296 G3DSA:3.40.50.300

TLQAKLLDQDLPYGVVSIVGMPGLGKTTLAKKLYRHVRHQFESSGLVYVSQQPRAGEILHDIAKQVGLPEEERKENLENNLRSLLKIKRYVILLDDIWDVEIWDHLKLVLPERDSKIGSRIIITSRNSN

HMMSmart: SM00382
IPR003593
179-313 AAA,NBS
ATPase, AAA+ type, core

PYGVVSIVGMPGLGKTTLAKKLYRHVRHQFESSGLVYVSQQPRAGEILHDIAKQVGLPEEERKENLENNLRSLLKIKRYVILLDDIWDVEIWDHLKLVLPERDSKIGSRIIITSRNSNVGRYIGGDFSIHVLQPL

FPrintScan: PR00364
IPR000767
182-197 DISEASERSIST
Disease resistance protein

VVSIVGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
251-265 DISEASERSIST
Disease resistance protein

LLKIKRYVILLDDIW

FPrintScan: PR00364
IPR000767
353-367 DISEASERSIST
Disease resistance protein

CGGIPLAIVVTAGIL

superfamily: SSF52058
480-832 SSF52058,LRR

RIHDMLHSLCVDLAEESNFFHTEYNAFGDLRNVARVRRITFYSDNVMNEFFRSNPNPKKLLALFCFTKDRCIFAQLAHLDFKLLQVLVVVMSQDGYGGFTMGNKFGKMSCLRYLRLEGVIRGKLLNNIVKLKCLETIGIGVGDIELPCSVWDFKQLRHVHCREELKGFFSNKPKHVAHDNLQTLMWMDDNFFEARLLHQLINLRKLGISSASNSTIKILSGLSPVPKTLEVLKLKFCNESSEQINLSSYLNIVKLHLNAAMRLTCEAFPPNLVKLTLVYLTVDDHVVAELKKLPKLRILKMVGCEHKKEEMDLSGDGFPQLEVLHIQNPLWLPEITCTDDVSMPKLKKLLLTG

Gene3D: G3DSA:3.80.10.10
675-832 G3DSA:3.80.10.10

LLHQLINLRKLGISSASNSTIKILSGLSPVPKTLEVLKLKFCNESSEQINLSSYLNIVKLHLNAAMRLTCEAFPPNLVKLTLVYLTVDDHVVAELKKLPKLRILKMVGCEHKKEEMDLSGDGFPQLEVLHIQNPLWLPEITCTDDVSMPKLKKLLLTG

FPrintScan: PR00364
IPR000767
770-786 DISEASERSIST
Disease resistance protein

KKLPKLRILKMVGCEHK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox