PRGDB00077374 (Stu.21043)

From PRG Wiki
Jump to: navigation, search
Stu.21043
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 280983119 (GT888858)
Gene Class RLK-GNK2
Domain Type Ser-Thr Kinase, GNK2
Gene Species Solanum tuberosum

Comment?

D30F04-700 Potato tubers 24 h infected with Fusarium eumartii Solanum tuberosum cDNA clone D30F04-700 5' similar to wall-associated kinase 2; similar to receptor-like serine

DNA Sequence

AAAGAGGGAAGCATCCGGTGTTACTGTCTATGGAGTAGCACAGTGTGCTGAAAGCATAACAGAAAGTGGTTGCCAAGATTGTTTGACAGTTGCATATAAGAACATAGAAGGCTGTTTACCTAAATATGCAGAAGGAAGGGCTGTTGATGCAGCATGTTTTATGAGGTTCTCGGATAGAGCTTTTTTTGCTGATAACTCGACAACTGATATCACACCATATCTTGGCGGAGGAGGAAGTTCAAACAAGAAGAAAGCCGCCATTATAGGGGGTGTCGCTGGAGGTGTAGGACTTCTTTTGATTATATTGGCTGTTTTCCTATGGTATCGACTATCAAGAAAGCCAAAGACAGCTGAGAGAGGTAATATACTGGGAGCAACTGAGCTGAGAGGCCCGGTGACCTACAGCTTCAAGGACCTAAAAATTGCTACCAAAGATTTCAACGAAAGTAATAAACTTGGTGAAGGCGGTTTTGGTGATGTATACAAGGGAACTTTGAAAAATGGAAATGTAGTAGCTGTTAAAAAACTAGCAATCATGTCAAGCAGAGCGAAAGCAGATTTTGAGACTGAGGTTCGTCTTATCAGTAATGTCCATCATCGCAATCTCATCCGTCTCTTGGGATGTTCTAACAAAGCGTCAGACCTACTACTTGTTTACGAATTCATGGCAAATGGCAGCCTCGAAAGATACTTATATGGCGACAGACGAGGGATGCTCAACTGGAAGCAAAGATTCAATATAATCTTTGGCACAGCTCGTGGCCTTGCATACTTGCACGAGCAATTCCACGTCTGCATCATCCATCGAGATATAAAATCCAGCAACATTCTACTAGACGACGAATTCCAGCCAAAGATTGCTGATTTTGGGCTTGTAAGACTTTTACCTGA


Protein sequences

Name Description Sequence
Stu.21043 translated coding region predicted by ESTScan from UniGene Stu.21043

XKREASGVTVYGVAQCAESITESGCQDCLTVAYKNIEGCLPKYAEGRAVDAACFMRFSDRAFFADNSTTDITPYLGGGGSSNKKKAAIIGGVAGGVGLLLIILAVFLWYRLSRKPKTAERGNILGATELRGPVTYSFKDLKIATKDFNESNKLGEGGFGDVYKGTLKNGNVVAVKKLAIMSSRAKADFETEVRLISNVHHRNLIRLLGCSNKASDLLLVYEFMANGSLERYLYGDRRGMLNWKQRFNIIFGTARGLAYLHEQFHVCIIHRDIKSSNILLDDEFQPKIADFGLVRLLPX

Domains

Domain Start-End Description Sequence

ProfileScan: PS51473
IPR002902
1-62 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

XKREASGVTVYGVAQCAESITESGCQDCLTVAYKNIEGCLPKYAEGRAVDAACFMRFSDRAF

HMMPfam: PF01657
IPR002902
7-62 Stress-antifung
Gnk2-homologous domain

GVTVYGVAQCAESITESGCQDCLTVAYKNIEGCLPKYAEGRAVDAACFMRFSDRAF

Seg: seg
76-81 seg

GGGGSS

HMMPanther: PTHR24420:SF575
79-297 OS11G0470200 PROTEIN

GSSNKKKAAIIGGVAGGVGLLLIILAVFLWYRLSRKPKTAERGNILGATELRGPVTYSFKDLKIATKDFNESNKLGEGGFGDVYKGTLKNGNVVAVKKLAIMSSRAKADFETEVRLISNVHHRNLIRLLGCSNKASDLLLVYEFMANGSLERYLYGDRRGMLNWKQRFNIIFGTARGLAYLHEQFHVCIIHRDIKSSNILLDDEFQPKIADFGLVRLLP

HMMPanther: PTHR24420
79-297 FAMILY NOT NAMED,FAMILY NOT NAMED

GSSNKKKAAIIGGVAGGVGLLLIILAVFLWYRLSRKPKTAERGNILGATELRGPVTYSFKDLKIATKDFNESNKLGEGGFGDVYKGTLKNGNVVAVKKLAIMSSRAKADFETEVRLISNVHHRNLIRLLGCSNKASDLLLVYEFMANGSLERYLYGDRRGMLNWKQRFNIIFGTARGLAYLHEQFHVCIIHRDIKSSNILLDDEFQPKIADFGLVRLLP

Gene3D: G3DSA:2.60.120.200
IPR013320
82-165 no description
Concanavalin A-like lectin/glucanase, subgroup

NKKKAAIIGGVAGGVGLLLIILAVFLWYRLSRKPKTAERGNILGATELRGPVTYSFKDLKIATKDFNESNKLGEGGFGDVYKGT

Seg: seg
86-105 seg

AAIIGGVAGGVGLLLIILAV

superfamily: SSF56112
IPR011009
119-297 Protein kinase-like (PK-like)
Protein kinase-like domain

ERGNILGATELRGPVTYSFKDLKIATKDFNESNKLGEGGFGDVYKGTLKNGNVVAVKKLAIMSSRAKADFETEVRLISNVHHRNLIRLLGCSNKASDLLLVYEFMANGSLERYLYGDRRGMLNWKQRFNIIFGTARGLAYLHEQFHVCIIHRDIKSSNILLDDEFQPKIADFGLVRLLP

ProfileScan: PS50011
IPR000719
147-298 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNESNKLGEGGFGDVYKGTLKNGNVVAVKKLAIMSSRAKADFETEVRLISNVHHRNLIRLLGCSNKASDLLLVYEFMANGSLERYLYGDRRGMLNWKQRFNIIFGTARGLAYLHEQFHVCIIHRDIKSSNILLDDEFQPKIADFGLVRLLPX

HMMSmart: SM00219
IPR020635
147-298 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FNESNKLGEGGFGDVYKGTLKNGNVVAVKKLAIMSSRAKADFETEVRLISNVHHRNLIRLLGCSNKASDLLLVYEFMANGSLERYLYGDRRGMLNWKQRFNIIFGTARGLAYLHEQFHVCIIHRDIKSSNILLDDEFQPKIADFGLVRLLPX

HMMSmart: SM00220
IPR002290
147-298 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FNESNKLGEGGFGDVYKGTLKNGNVVAVKKLAIMSSRAKADFETEVRLISNVHHRNLIRLLGCSNKASDLLLVYEFMANGSLERYLYGDRRGMLNWKQRFNIIFGTARGLAYLHEQFHVCIIHRDIKSSNILLDDEFQPKIADFGLVRLLPX

HMMPfam: PF00069
IPR017442
149-294 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ESNKLGEGGFGDVYKGTLKNGNVVAVKKLAIMSSRAKADFETEVRLISNVHHRNLIRLLGCSNKASDLLLVYEFMANGSLERYLYGDRRGMLNWKQRFNIIFGTARGLAYLHEQFHVCIIHRDIKSSNILLDDEFQPKIADFGLVR

PatternScan: PS00107
IPR017441
153-176 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGDVYKGTLKNGNVVAVKK

Gene3D: G3DSA:3.30.200.20
166-208 no description

LKNGNVVAVKKLAIMSSRAKADFETEVRLISNVHHRNLIRLLG

Gene3D: G3DSA:1.10.510.10
209-296 no description

CSNKASDLLLVYEFMANGSLERYLYGDRRGMLNWKQRFNIIFGTARGLAYLHEQFHVCIIHRDIKSSNILLDDEFQPKIADFGLVRLL

PatternScan: PS00108
IPR008271
267-279 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox