PRGDB00077382 (Stu.21349)

From PRG Wiki
Jump to: navigation, search
Stu.21349
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21922723 (BQ506873)
Gene Class Mlo-like
Domain Type MLO
Gene Species Solanum tuberosum

Comment?

EST614288 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissues Solanum tuberosum cDNA clone STMGM92 5' end, mRNA sequence

DNA Sequence

GTAAAGATGGCGGAAAAGTCTGAGTCTCTCGAGTATACACCAACATGGGTTGTTGCCGTTGTCTGCTTCATCATTGTTCTCATTTCACTTGCTGCTGAACGTGGCCTACATCGCCTTGGAAAGTTCTTCCTGCAAAAGAATCAAGATGCCCTATTCAAGGCACTCCAGAAATTAAAAGAAGAATTGATGCTTTTGGGATTTATTTCATTACTATTAACGGTGTCTCAAGGGGCAATAAGCAAAATATGCGTTCCTGAAAATATTTCAAAAGTAATGCTTCCATGCAAGCTTAAAGAATCTGCAACTTCTAATCATCTCATCACTGGGAGACATCTTTTAGCTGGATCTAGCGGTGCAGAACATTGTAATCGTCATGAGGGAAAAGTTCCACTATTATCATTGGAGGCATTGCATCAACTACATATTTTCATATTTGTATTGGCAGTCACACATGTGATCTTCTGTGCCACCACCATGGTTCTTGGAGGGGCAAAGATACAACAATGGAGACACTGGGAGAACTCAATTCAAAAGCAATCAAAACCACATCATGTGCATATTCTCCATATTCAATCATTTGTGGATAGAGCTGGTAGACGTTGGAGAAAGTACGCTCTCGTTAGTTGGACGGTGGCTTTTTTCAAACATTTTATGGTTCAGTAACAAAGTCGGACTATATTGTCTTGCGGACTGGATTATCAAGAAACATGTCATCCATCCTAGTTAATTTCACAATATATATTGCGACCTGG


Protein sequences

Name Description Sequence
Stu.21349 translated coding region predicted by ESTScan from UniGene Stu.21349

MAEKSESLEYTPTWVVAVVCFIIVLISLAAERGLHRLGKFFLQKNQDALFKALQKLKEELMLLGFISLLLTVSQGAISKICVPENISKVMLPCKLKESATSNHLITGRHLLAGSSGAEHCNRHEGKVPLLSLEALHQLHIFIFVLAVTHVIFCATTMVLGGAKIQQWRHWENSIQKQSKPHHVHILHIQSFVDRAGRRWRKYALVSW

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
5-207 Mlo
Mlo-related protein

SESLEYTPTWVVAVVCFIIVLISLAAERGLHRLGKFFLQKNQDALFKALQKLKEELMLLGFISLLLTVSQGAISKICVPENISKVMLPCKLKESATSNHLITGRHLLAGSSGAEHCNRHEGKVPLLSLEALHQLHIFIFVLAVTHVIFCATTMVLGGAKIQQWRHWENSIQKQSKPHHVHILHIQSFVDRAGRRWRKYALVSW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox