PRGDB00077387 (Stu.21797)

From PRG Wiki
Jump to: navigation, search
Stu.21797
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21372968 (BQ514099)
Gene Class N
Domain Type NBS
Gene Species Solanum tuberosum

Comment?

EST621514 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissues Solanum tuberosum cDNA clone STMIJ69 5' end, mRNA sequence

DNA Sequence

GAAAAAGGGAAAGGATTTGTGGCTTACGATTCAACATAATCTGGATTCCTGCATATCTGCCAACAACAATTCGCAGATGATGAAGGTTATGCAATTAAGTTATGACCATTTACCATACCACCTGAAGCCATTGTTGCTTTACTTCGGAAGATCTCAAAAAAGCAAACAAACTCCAGTCTCTAAGTTGATGCAGTTGTGGATGGCTGAAGGGTTGGTGGATCATGATATCCAGTCCAAGAGTAGTTTAGAGGAAACAACTCAAAGTTACTTGGATGCTTTAATTTCCAGTAGCCTGATAATGGTGGATCATTTCCCGTCCAAGGTTTGCTACGTGCATGATGTTGTGCACCATTTTTGTTCAGTAAAAGCCAAAAAGGAAAAGTTTATCAAGTTAATCAATTCAGGTGCACGATTTCATGCTTCGGATTTCCTACACCGTCGTCTAACCATTCATACTGACAAGGGCCAACTCCACAAAAAATGTGTTTTGTTCAATTCTAATAAGTGTTCAGCTGGAAGTAAGCATCTCATATCTTTGAAAGTGAGCGGTTCGCATCTTAACTCCAGGTATATTTGTCACACTAGACACTTGAGACTTGTTAGAGTGTTGCAAATGGGTAACACTGATCTGGGAGAAATTCTTATGG


Protein sequences

Name Description Sequence
Stu.21797 translated coding region predicted by ESTScan from UniGene Stu.21797

XKKGKDLWLTIQHNLDSCISANNNSQMMKVMQLSYDHLPYHLKPLLLYFGRSQKSKQTPVSKLMQLWMAEGLVDHDIQSKSSLEETTQSYLDALISSSLIMVDHFPSKVCYVHDVVHHFCSVKAKKEKFIKLINSGARFHASDFLHRRLTIHTDKGQLHKKCVLFNSNKCSAGSKHLISLKVSGSHLNSRYICHTRHLRLVRVLQMGNTDLGEILMX

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
6-74 NB-ARC,NBS
NB-ARC

DLWLTIQHNLDSCISANNNSQMMKVMQLSYDHLPYHLKPLLLYFGRSQKSKQTPVSKLMQLWMAEGLVD

Seg: seg
37-48 seg

HLPYHLKPLLLY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox