PRGDB00077396 (Stu.22172)

From PRG Wiki
Jump to: navigation, search
Stu.22172
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 57963327 (CX700234)
Gene Class T
Domain Type TIR, LRR
Gene Species Solanum tuberosum

Comment?

87079.1 Stolon Solanum tuberosum cDNA clone 87079 5', mRNA sequence

DNA Sequence

CTTCTTCTTCTTTTGCGATTGATTCACAATACCGTCCGCTATGGAAGTATGATGTCTTTCTATGTTTTAGAGGTGCCGACACTCGGAGAACATTTACGGGTCACTTGTACGAAGGTTTGAAAAACAGGGGAATATTCACCTTTCAAGATGATATAAGGCTAGAGAATGGCGATTCCATCCCAGAAGAACTCTTGAAAGCTATCGAAGAGTCTCAAGTTGCCCTTGTCATTTTCTCAAAGAATTATGCTACATCGAGGTGGTGCTTGAATGAATTAGTGAAGATCATGGAATGCAAGGAAGAAAATGAACAAATAGTCATACCGGTCTTCTATGATGTGTATCCATCAGAAGTTCGACACCAAACAGAGAGCTTTGCAGTAGCATTTGCCGAACATGAAAAGAAGTATAAAGATGATGTTGAGGGGATGCAGAAGGTGAAAGGATGGAGAACTGCCCTAAGTGCTGCCGCTGATCTAAAAGGTTGTAATGTTCATGACAGGTGAGTAAAAAACACACAAGTTGAATCATAAATTTATTTATCATGAAGACTAGTTACACACAATAGTTAGCTAATAATCTACTATAGAACAACTGTGTACCTCAAAAATTTATCTATTTCTATCGAGTGAATAAATTTTATGGTCATCCAAGTATACCAAAATTACTTGCTAAAGTCACGTTTATATATTTTAATCATTTAATTACTCAATGACATTGTTACATAGATAAT


Protein sequences

Name Description Sequence
Stu.22172 translated coding region predicted by ESTScan from UniGene Stu.22172

XSSSFAIDSQYRPLWKYDVFLCFRGADTRRTFTGHLYEGLKNRGIFTFQDDIRLENGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEENEQIVIPVFYDVYPSEVRHQTESFAVAFAEHEKKYKDDVEGMQKVKGWRTALSAAADLKGCNVHDR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
5-162 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

FAIDSQYRPLWKYDVFLCFRGADTRRTFTGHLYEGLKNRGIFTFQDDIRLENGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEENEQIVIPVFYDVYPSEVRHQTESFAVAFAEHEKKYKDDVEGMQKVKGWRTALSAAADLKGC

Gene3D: G3DSA:3.40.50.10140
15-141 no description

WKYDVFLCFRGADTRRTFTGHLYEGLKNRGIFTFQDDIRLENGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEENEQIVIPVFYDVYPSEVRHQTESFAVAFAEHEKKYKDDVE

ProfileScan: PS50104
IPR000157
15-159 TIR
Toll-Interleukin receptor

WKYDVFLCFRGADTRRTFTGHLYEGLKNRGIFTFQDDIRLENGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEENEQIVIPVFYDVYPSEVRHQTESFAVAFAEHEKKYKDDVEGMQKVKGWRTALSAAADL

HMMSmart: SM00255
IPR000157
16-159 Toll
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFLCFRGADTRRTFTGHLYEGLKNRGIFTFQDDIRLENGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEENEQIVIPVFYDVYPSEVRHQTESFAVAFAEHEKKYKDDVEGMQKVKGWRTALSAAADL

HMMPfam: PF01582
IPR000157
19-154 TIR
Toll-Interleukin receptor

VFLCFRGADTRRTFTGHLYEGLKNRGIFTFQDDIRLENGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEENEQIVIPVFYDVYPSEVRHQTESFAVAFAEHEKKYKDDVEGMQKVKGWRTALS

HMMPanther: PTHR23155:SF344
28-164 SUBFAMILY NOT NAMED

TRRTFTGHLYEGLKNRGIFTFQDDIRLENGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEENEQIVIPVFYDVYPSEVRHQTESFAVAFAEHEKKYKDDVEGMQKVKGWRTALSAAADLKGCNV

HMMPanther: PTHR23155
28-164 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRRTFTGHLYEGLKNRGIFTFQDDIRLENGDSIPEELLKAIEESQVALVIFSKNYATSRWCLNELVKIMECKEENEQIVIPVFYDVYPSEVRHQTESFAVAFAEHEKKYKDDVEGMQKVKGWRTALSAAADLKGCNV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox