PRGDB00077402 (Stu.23029)

From PRG Wiki
Jump to: navigation, search
Stu.23029
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 50272994 (CO502808)
Gene Class T
Domain Type TIR, LRR
Gene Species Solanum tuberosum

Comment?

60086.1 In vitro Root Solanum tuberosum cDNA clone 60086 5', mRNA sequence

DNA Sequence

ATTCACAGAAACATTCATCNTTTCATTTGGCNTTTATATTTCTTCATCTTATGAGTTTATCACACCTACACATAGTTTGTATTTCTTCTCAGACATCCATGGCAtcttcttcttcttcttcttcttATGCGAGTGATTCGCAATACCGTCCGCTATGGAAGTATGATGTCTTTTAAGTTTTAGAGGTGTCGACACTCGGAGAACATTTACGGGTCACTTGTACGAAGGTTTGGAAAACAGTGCAATATGCACCTTTCAAGATGATAAAAGGCTAGAGATTGGCGATTCCATCCCAGAAGAACTCTTGAAAGCTATCGAAGAGTCTCAAGTTGCTCTTGTCATTTTCTCAAAGAAGTATGCTACATCTAGGTGGTGCTTGAACGAACTAGTAAAGATCATGGAATGCAAGGAAGAAAAAGGACTAATAGTCATACCGGTCTTCTATGATGTATATCCATCAGTGGTTCGGAAGCAAAAAAAGAGCTTTAAAGTAGCATTTGACCAACATGAATCGGAGTATGCGAATGATGATGAAGGAAAGCAGAAGGTGAAAGGATGGAGAACTGCTCTAAGTGCTGCCGCTGATCTAAAAGGTTGTAATGTTCATCGCAGGTGAGTAAAAAAACACACAAGTTGAATCATAAATTTATTTATCATGAAGACTATTACACACAATAGCTAGCTAATATTCTACTATAGAAACAACTGTGTACCTCAAAAAATTTATTTANTTTCAATCGAGTAAATAAATTTATGGTCATCCAAGTATACCTAAATTACTTGCTaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Stu.23029 translated coding region predicted by ESTScan from UniGene Stu.23029

MASSSSSSSYASDSQYRPLWKYDXLLSFRGVDTRRTFTGHLYEGLENSAICTFQDDKRLEIGDSIPEELLKAIEESQVALVIFSKKYATSRWCLNELVKIMECKEEKGLIVIPVFYDVYPSVVRKQKKSFKVAFDQHESEYANDDEGKQKVKGWRTALSAAADLKGCNVHRR

Domains

Domain Start-End Description Sequence

Seg: seg
2-14 seg

ASSSSSSSYASDS

superfamily: SSF52200
IPR000157
10-167 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

YASDSQYRPLWKYDXLLSFRGVDTRRTFTGHLYEGLENSAICTFQDDKRLEIGDSIPEELLKAIEESQVALVIFSKKYATSRWCLNELVKIMECKEEKGLIVIPVFYDVYPSVVRKQKKSFKVAFDQHESEYANDDEGKQKVKGWRTALSAAADLKGC

ProfileScan: PS50104
IPR000157
20-164 TIR
Toll-Interleukin receptor

WKYDXLLSFRGVDTRRTFTGHLYEGLENSAICTFQDDKRLEIGDSIPEELLKAIEESQVALVIFSKKYATSRWCLNELVKIMECKEEKGLIVIPVFYDVYPSVVRKQKKSFKVAFDQHESEYANDDEGKQKVKGWRTALSAAADL

Gene3D: G3DSA:3.40.50.10140
20-158 no description

WKYDXLLSFRGVDTRRTFTGHLYEGLENSAICTFQDDKRLEIGDSIPEELLKAIEESQVALVIFSKKYATSRWCLNELVKIMECKEEKGLIVIPVFYDVYPSVVRKQKKSFKVAFDQHESEYANDDEGKQKVKGWRTAL

HMMSmart: SM00255
IPR000157
21-164 Toll
Toll/interleukin-1 receptor homology (TIR) domain

KYDXLLSFRGVDTRRTFTGHLYEGLENSAICTFQDDKRLEIGDSIPEELLKAIEESQVALVIFSKKYATSRWCLNELVKIMECKEEKGLIVIPVFYDVYPSVVRKQKKSFKVAFDQHESEYANDDEGKQKVKGWRTALSAAADL

HMMPfam: PF01582
IPR000157
26-159 TIR
Toll-Interleukin receptor

LSFRGVDTRRTFTGHLYEGLENSAICTFQDDKRLEIGDSIPEELLKAIEESQVALVIFSKKYATSRWCLNELVKIMECKEEKGLIVIPVFYDVYPSVVRKQKKSFKVAFDQHESEYANDDEGKQKVKGWRTALS

HMMPanther: PTHR23155:SF344
33-169 SUBFAMILY NOT NAMED

TRRTFTGHLYEGLENSAICTFQDDKRLEIGDSIPEELLKAIEESQVALVIFSKKYATSRWCLNELVKIMECKEEKGLIVIPVFYDVYPSVVRKQKKSFKVAFDQHESEYANDDEGKQKVKGWRTALSAAADLKGCNV

HMMPanther: PTHR23155
33-169 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRRTFTGHLYEGLENSAICTFQDDKRLEIGDSIPEELLKAIEESQVALVIFSKKYATSRWCLNELVKIMECKEEKGLIVIPVFYDVYPSVVRKQKKSFKVAFDQHESEYANDDEGKQKVKGWRTALSAAADLKGCNV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox