PRGDB00077405 (Stu.23198)

From PRG Wiki
Jump to: navigation, search
Stu.23198
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 62893437 (DN908674)
Gene Class T
Domain Type TIR, LRR
Gene Species Solanum tuberosum

Comment?

46349.2 Developing Tubers Solanum tuberosum cDNA clone 46349 5', mRNA sequence

DNA Sequence

CATTTGATCTTAATGGTTTCTAACCTTAAGGATTTATAAAGAGTAGCCTGAAAATACTTCCCCTCTATATGAGACCCTTCACCCATGGCTAATTTGTATTCACCATGTTATGACGTTTTCTTGAATTTTAGGGGAAAAGATGTACGCAGAACTTTTTTAGATCATCTCTATAAAGCATTATGTGATGTTGGAATTAATGTGTTTAGAGATGATGATGAACTTCCAAGAGGCGAGGACATTTCAGGGAGTTTACTTGAAGCAATTGAAGAGTCAAAAATTTCTCTTGTTGTTTTCTCCAAAAATTATGCATCATCTAAATGGTGTCTTAATGAGCTGGTCAAAATTCTTGAATGTAAAGAAAAACTTGGACAGCACATTTTTCCTATTTTTTATGATGTTGATCCTTCTGAAGTACGCCATCAAACTGGGAAAATTGGAGATTCCCTTGCCAAACATGAATCCAATTCAAGTCGAGAACAGTTGAGGAAGTGGAGAGCTGCACTTACTGCAGTTGCAAGTTTATCCGGATTCCATCTTCAAAATCATTTTAACGGGTAATAGTTCTTGCCATCTGTATTTATTTTTGTAAGAAAAATCTGTTCCCAATTTTCATGAGAGTTGATAtttccttttcttttttctgttttctcttctGAATACACATTTGCTAGCCCGGCAGTGTTTAGAACATGGGCAATACAAAGATACAGTTCTGCTTAATTAATTCCATCTTTTCTGTATAA


Protein sequences

Name Description Sequence
Stu.23198 translated coding region predicted by ESTScan from UniGene Stu.23198

MANLYSPCYDVFLNFRGKDVRRTFLDHLYKALCDVGINVFRDDDELPRGEDISGSLLEAIEESKISLVVFSKNYASSKWCLNELVKILECKEKLGQHIFPIFYDVDPSEVRHQTGKIGDSLAKHESNSSREQLRKWRAALTAVASLSGFHLQNHFNG

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
6-149 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

SPCYDVFLNFRGKDVRRTFLDHLYKALCDVGINVFRDDDELPRGEDISGSLLEAIEESKISLVVFSKNYASSKWCLNELVKILECKEKLGQHIFPIFYDVDPSEVRHQTGKIGDSLAKHESNSSREQLRKWRAALTAVASLSGF

ProfileScan: PS50104
IPR000157
7-146 TIR
Toll-Interleukin receptor

PCYDVFLNFRGKDVRRTFLDHLYKALCDVGINVFRDDDELPRGEDISGSLLEAIEESKISLVVFSKNYASSKWCLNELVKILECKEKLGQHIFPIFYDVDPSEVRHQTGKIGDSLAKHESNSSREQLRKWRAALTAVASL

Gene3D: G3DSA:3.40.50.10140
8-143 no description

CYDVFLNFRGKDVRRTFLDHLYKALCDVGINVFRDDDELPRGEDISGSLLEAIEESKISLVVFSKNYASSKWCLNELVKILECKEKLGQHIFPIFYDVDPSEVRHQTGKIGDSLAKHESNSSREQLRKWRAALTAV

HMMSmart: SM00255
IPR000157
8-146 Toll
Toll/interleukin-1 receptor homology (TIR) domain

CYDVFLNFRGKDVRRTFLDHLYKALCDVGINVFRDDDELPRGEDISGSLLEAIEESKISLVVFSKNYASSKWCLNELVKILECKEKLGQHIFPIFYDVDPSEVRHQTGKIGDSLAKHESNSSREQLRKWRAALTAVASL

HMMPfam: PF01582
IPR000157
11-141 TIR
Toll-Interleukin receptor

VFLNFRGKDVRRTFLDHLYKALCDVGINVFRDDDELPRGEDISGSLLEAIEESKISLVVFSKNYASSKWCLNELVKILECKEKLGQHIFPIFYDVDPSEVRHQTGKIGDSLAKHESNSSREQLRKWRAALT

HMMPanther: PTHR23155:SF344
20-148 SUBFAMILY NOT NAMED

VRRTFLDHLYKALCDVGINVFRDDDELPRGEDISGSLLEAIEESKISLVVFSKNYASSKWCLNELVKILECKEKLGQHIFPIFYDVDPSEVRHQTGKIGDSLAKHESNSSREQLRKWRAALTAVASLSG

HMMPanther: PTHR23155
20-148 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VRRTFLDHLYKALCDVGINVFRDDDELPRGEDISGSLLEAIEESKISLVVFSKNYASSKWCLNELVKILECKEKLGQHIFPIFYDVDPSEVRHQTGKIGDSLAKHESNSSREQLRKWRAALTAVASLSG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox