PRGDB00077413 (Stu.24152)

From PRG Wiki
Jump to: navigation, search
Stu.24152
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 160518577 (AM906504)
Gene Class T
Domain Type TIR, LRR
Gene Species Solanum tuberosum

Comment?

AM906504 Solanum tuberosum cv. Yungay leaf adult Solanum tuberosum cDNA clone 5E5, mRNA sequence

DNA Sequence

ATCAGGCAGAGGACGAGACAGAACGCAGAAAGAAGGGCAATTTCTTAGTCATTGAGATTACTGCACCTTTCGATTCATCAATAACGCCGGAGAAATCCATCTCTGTCCTCGTCGTCTTCCTCCGCACACAGATAATTAATTGAATCTATGGCATCATCTTCTTCTGCGAGTAATTCACAGTACTGTCCTCCATGGAAGTACAAGGTCTTTCTAAGTTTCAGAGGAGTTGATACCCGGAATAATTTTACGAGTCACTTGTACAAAGGTTTGGAAAATAGGGGAATATTCACCTTTCTAGATGATGAAAGGCTAGAGGATGGCGATTCCATCTCAAAAGAACTCGTGCAAGCGATAGAAAAGTCTCAAGTTGCTGTAATCGTTTTCTCAAAAAATTATGCTACGTCAAGGTGGTGCTTGAATGAACTAGTGAAGATTATGGAATGCAAGGAGAAAGAAAATGGACAAACAGTTATACCGGTCTTCTATGATGTGTACCCATCACATGTTCGATACCAAAGTGAGAGCTTTGCAGAAGCATTTGCCAAACACGAATCGAGGTATAAGGATGATGTGGGGATGCAGAAGGTTCAAGGACGGAGGAATGCCCTAACTGCTGCCGCAGATCTAAAAGGACATGCTATTCATGACGGGTGAGTTGGAAACAAATAATTGCTTTTGATGaaaaaaaaTAACAATATGTTTCTATATATTATCCTG


Protein sequences

Name Description Sequence
Stu.24152 translated coding region predicted by ESTScan from UniGene Stu.24152

MASSSSASNSQYCPPWKYKVFLSFRGVDTRNNFTSHLYKGLENRGIFTFLDDERLEDGDSISKELVQAIEKSQVAVIVFSKNYATSRWCLNELVKIMECKEKENGQTVIPVFYDVYPSHVRYQSESFAEAFAKHESRYKDDVGMQKVQGRRNALTAAADLKGHAIHDG

Domains

Domain Start-End Description Sequence

Seg: seg
2-10 seg

ASSSSASNS

superfamily: SSF52200
IPR000157
6-163 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

SASNSQYCPPWKYKVFLSFRGVDTRNNFTSHLYKGLENRGIFTFLDDERLEDGDSISKELVQAIEKSQVAVIVFSKNYATSRWCLNELVKIMECKEKENGQTVIPVFYDVYPSHVRYQSESFAEAFAKHESRYKDDVGMQKVQGRRNALTAAADLKGH

Gene3D: G3DSA:3.40.50.10140
16-137 no description

WKYKVFLSFRGVDTRNNFTSHLYKGLENRGIFTFLDDERLEDGDSISKELVQAIEKSQVAVIVFSKNYATSRWCLNELVKIMECKEKENGQTVIPVFYDVYPSHVRYQSESFAEAFAKHESR

ProfileScan: PS50104
IPR000157
16-160 TIR
Toll-Interleukin receptor

WKYKVFLSFRGVDTRNNFTSHLYKGLENRGIFTFLDDERLEDGDSISKELVQAIEKSQVAVIVFSKNYATSRWCLNELVKIMECKEKENGQTVIPVFYDVYPSHVRYQSESFAEAFAKHESRYKDDVGMQKVQGRRNALTAAADL

HMMSmart: SM00255
IPR000157
17-160 Toll
Toll/interleukin-1 receptor homology (TIR) domain

KYKVFLSFRGVDTRNNFTSHLYKGLENRGIFTFLDDERLEDGDSISKELVQAIEKSQVAVIVFSKNYATSRWCLNELVKIMECKEKENGQTVIPVFYDVYPSHVRYQSESFAEAFAKHESRYKDDVGMQKVQGRRNALTAAADL

HMMPfam: PF01582
IPR000157
20-155 TIR
Toll-Interleukin receptor

VFLSFRGVDTRNNFTSHLYKGLENRGIFTFLDDERLEDGDSISKELVQAIEKSQVAVIVFSKNYATSRWCLNELVKIMECKEKENGQTVIPVFYDVYPSHVRYQSESFAEAFAKHESRYKDDVGMQKVQGRRNALT

HMMPanther: PTHR23155:SF344
29-162 SUBFAMILY NOT NAMED

TRNNFTSHLYKGLENRGIFTFLDDERLEDGDSISKELVQAIEKSQVAVIVFSKNYATSRWCLNELVKIMECKEKENGQTVIPVFYDVYPSHVRYQSESFAEAFAKHESRYKDDVGMQKVQGRRNALTAAADLKG

HMMPanther: PTHR23155
29-162 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRNNFTSHLYKGLENRGIFTFLDDERLEDGDSISKELVQAIEKSQVAVIVFSKNYATSRWCLNELVKIMECKEKENGQTVIPVFYDVYPSHVRYQSESFAEAFAKHESRYKDDVGMQKVQGRRNALTAAADLKG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox