PRGDB00077415 (Stu.24304)

From PRG Wiki
Jump to: navigation, search
Stu.24304
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 52567862 (CV286538)
Gene Class TNL
Domain Type NBS, TIR, LRR
Gene Species Solanum tuberosum

Comment?

66826.1 After-Cooking Darkening A Solanum tuberosum cDNA clone 66826 5', mRNA sequence

DNA Sequence

GGAATTAAGAAAGGGAGACGTCATTTCAACCGAACTTGAGAAAGCAATTGAAGAATCTAGGGTTGCCATTGTTGTTTTCTCCAAAAATTATGCTTCCTCTAGTTGGTGTCTTGATGAACTTGTCAAAATTCTCGATTGCAGAGAGAGGTTAAATCAGGTAGTTTTGCCTATTTTCTATGATGTTGATCCTTCTCAAGTGCGAAAGCAAACTGGGTCCTTTGGTGATGCTTTGGCAAAACATAAGGAACGATTGTTTGGAGCTGAAAGGGTGGAGAAGTGGAAAGGTGCACTAACTGAAGCTGCGAATTTATCTGGATGGGATTTGCAAAATATTGCTGATGGGTAAGACTTCTTAATTCAACTATAAGATTTTGATTTTAAGCGTTTGCCTAATCTTATAAGTTGGTTAATTATGGAAAATTTCAAAATATTTCTATAGTTTTTAAATTCCATGTCAAATCAAACTACATCACATGAATTGGGACGAGGGAGTAGTAGTAATGGACAATCTCCATTCTCTAACCTCAATTTCCCTATCGGCTATTGTCTGTTGGGTATGGATTTTGTTTTGTTCATCAAATATTTTCAAATATCAAAGTTTCGtttttttaattttAACCTCTGTTATTGCTGAAAAACCGTAGGCATGAATCAAAATTTATTGAAAGTATTATAAAACAAGTTCTGCAAGAGGCCAACCAGACACCTCTAGATGTTGCTCATTACCCAATTGGATTAGATTCTCCTATCGAGCATATAGAGTTGTTACTGCAAAGTGGATGTGAGCATGAAGTTCGCATGGTTGGATATGTGGCGTTGGTGGAATTGGAAAAACAATCTAGGCAAAAGGTAT


Protein sequences

Name Description Sequence
Stu.24304 translated coding region predicted by ESTScan from UniGene Stu.24304

XELRKGDVISTELEKAIEESRVAIVVFSKNYASSSWCLDELVKILDCRERLNQVVLPIFYDVDPSQVRKQTGSFGDALAKHKERLFGAERVEKWKGALTEAANLSGWDLQNIADG

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
1-104 TIR
Toll-Interleukin receptor

XELRKGDVISTELEKAIEESRVAIVVFSKNYASSSWCLDELVKILDCRERLNQVVLPIFYDVDPSQVRKQTGSFGDALAKHKERLFGAERVEKWKGALTEAANL

HMMSmart: SM00255
IPR000157
1-104 Toll
Toll/interleukin-1 receptor homology (TIR) domain

XELRKGDVISTELEKAIEESRVAIVVFSKNYASSSWCLDELVKILDCRERLNQVVLPIFYDVDPSQVRKQTGSFGDALAKHKERLFGAERVEKWKGALTEAANL

Gene3D: G3DSA:3.40.50.10140
2-94 no description

ELRKGDVISTELEKAIEESRVAIVVFSKNYASSSWCLDELVKILDCRERLNQVVLPIFYDVDPSQVRKQTGSFGDALAKHKERLFGAERVEKW

superfamily: SSF52200
IPR000157
2-107 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

ELRKGDVISTELEKAIEESRVAIVVFSKNYASSSWCLDELVKILDCRERLNQVVLPIFYDVDPSQVRKQTGSFGDALAKHKERLFGAERVEKWKGALTEAANLSGW

HMMPfam: PF01582
IPR000157
3-99 TIR
Toll-Interleukin receptor

LRKGDVISTELEKAIEESRVAIVVFSKNYASSSWCLDELVKILDCRERLNQVVLPIFYDVDPSQVRKQTGSFGDALAKHKERLFGAERVEKWKGALT

HMMPanther: PTHR23155:SF301
7-114 DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS), PUTATIVE

DVISTELEKAIEESRVAIVVFSKNYASSSWCLDELVKILDCRERLNQVVLPIFYDVDPSQVRKQTGSFGDALAKHKERLFGAERVEKWKGALTEAANLSGWDLQNIAD

HMMPanther: PTHR23155
7-114 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVISTELEKAIEESRVAIVVFSKNYASSSWCLDELVKILDCRERLNQVVLPIFYDVDPSQVRKQTGSFGDALAKHKERLFGAERVEKWKGALTEAANLSGWDLQNIAD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox