PRGDB00077422 (Stu.24390)

From PRG Wiki
Jump to: navigation, search
Stu.24390
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 13607977 (BG589837)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Solanum tuberosum

Comment?

EST497679 P. infestans-challenged leaf Solanum tuberosum cDNA clone BPLI3K3 5' sequence, mRNA sequence

DNA Sequence

GCAGAGAAGTAACAGTACGCAATGGGAGGTACTAGTCGATAAAATTCGACGTACAGTATATAAAGCAGAGGATGTTGTTGATAAATTATTGATTCAGGCCAAGATAGACCAAGAGAGTAATATAGCTAAAAAATTGATTCACAAAACTTACAAAAACAGGAATTTTACAGAGGAAATCAATGAGATACTTGAAGAGATGAGGAAAATCCTTGATGAAAATCAACATTTGTTTGAGGCCAACCCAATGATTGATCATCATACTGAAAAAGTTGTCCAGGAGGAACAGGGTTCGTCATTGGAAAATCACGAAGTGGTTGGATTTGATGAGGAAGCAACAAAAGTGATCAATCGTCTGGTTGAAGGAGCAGAGTGTCTAGATGTTATCCCCGTTGTAGGAATGCCAGGACTTGGTAAAACCACACTGGCAAGAAAAATCTATAATGATCCTAAGATTTCGCGAGAATTTTTCAGTTACATTTGGGTTTTCATCGGACAATCAACGTGTGTAAAACGGGATATCCTTTTTAATATTCTGAAAGGGTTCACAAATTCCTTTGATGAATTCAAAAACAGAAATGAGGCAGACATAACTCAGGAAATATGTAAGCGCGTGGCTAATGGAAGTAAATGTCTCATTGTCTTGGATGATGTGTGGGATCCAAATGTTGTAGATTTTGTCAAGACAG


Protein sequences

Name Description Sequence
Stu.24390 translated coding region predicted by ESTScan from UniGene Stu.24390

XQRSNSTQWEVLVDKIRRTVYKAEDVVDKLLIQAKIDQESNIAKKLIHKTYKNRNFTEEINEILEEMRKILDENQHLFEANPMIDHHTEKVVQEEQGSSLENHEVVGFDEEATKVINRLVEGAECLDVIPVVGMPGLGKTTLARKIYNDPKISREFFSYIWVFIGQSTCVKRDILFNILKGFTNSFDEFKNRNEADITQEICKRVANGSKCLIVLDDVWDPNVVDFVKTX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
2-222 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

QRSNSTQWEVLVDKIRRTVYKAEDVVDKLLIQAKIDQESNIAKKLIHKTYKNRNFTEEINEILEEMRKILDENQHLFEANPMIDHHTEKVVQEEQGSSLENHEVVGFDEEATKVINRLVEGAECLDVIPVVGMPGLGKTTLARKIYNDPKISREFFSYIWVFIGQSTCVKRDILFNILKGFTNSFDEFKNRNEADITQEICKRVANGSKCLIVLDDVWDPN

HMMPanther: PTHR23155
2-222 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QRSNSTQWEVLVDKIRRTVYKAEDVVDKLLIQAKIDQESNIAKKLIHKTYKNRNFTEEINEILEEMRKILDENQHLFEANPMIDHHTEKVVQEEQGSSLENHEVVGFDEEATKVINRLVEGAECLDVIPVVGMPGLGKTTLARKIYNDPKISREFFSYIWVFIGQSTCVKRDILFNILKGFTNSFDEFKNRNEADITQEICKRVANGSKCLIVLDDVWDPN

Coil: coil
53-74 coiled-coil

NRNFTEEINEILEEMRKILDEN

superfamily: SSF52540
88-228 P-loop containing nucleoside triphosphate hydrolases

TEKVVQEEQGSSLENHEVVGFDEEATKVINRLVEGAECLDVIPVVGMPGLGKTTLARKIYNDPKISREFFSYIWVFIGQSTCVKRDILFNILKGFTNSFDEFKNRNEADITQEICKRVANGSKCLIVLDDVWDPNVVDFVK

Gene3D: G3DSA:3.40.50.300
105-221 no description

VVGFDEEATKVINRLVEGAECLDVIPVVGMPGLGKTTLARKIYNDPKISREFFSYIWVFIGQSTCVKRDILFNILKGFTNSFDEFKNRNEADITQEICKRVANGSKCLIVLDDVWDP

HMMPfam: PF00931
IPR002182
109-226 NB-ARC,NBS
NB-ARC

DEEATKVINRLVEGAECLDVIPVVGMPGLGKTTLARKIYNDPKISREFFSYIWVFIGQSTCVKRDILFNILKGFTNSFDEFKNRNEADITQEICKRVANGSKCLIVLDDVWDPNVVDF

FPrintScan: PR00364
IPR000767
128-143 DISEASERSIST
Disease resistance protein

VIPVVGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
205-219 DISEASERSIST
Disease resistance protein

VANGSKCLIVLDDVW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox