PRGDB00077441 (Ta.257)

From PRG Wiki
Jump to: navigation, search
Ta.257
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 11990499 (AF149114)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum stripe rust resistance protein Yr10 (Yr10) mRNA, complete cds

DNA Sequence

ATGGAGGTCGTGACCGGGGCGATGAGCACGCTCCTGCCCTTGCTTGGCGACCTGCTTAAGGAGGAGTACAACCTGCAGAAGAGCACCAAGGGTGAGATCAAGTTCCTCAAAGCAGAGCTGGAGAGCATGGAGGCTGCCCTCATCAAGATCTCGGAGGCACCCTTGGATCAGCCACCTAACATTCAGGTCAAGCTCTGGGCGAGGGACGTCAAGGACCTGTCCTATGAGATCGAAGATGGCATCGACAAATTCCGGGTGCACCTTGAGTGCCGGCAACAAAAGAAGCCACACAGCTTTATGGGTTTCATCCACAAAAGCATGGACATGCTGACAAAGGGCAAGATCCGACACAAAATAGGCATCGATATCAAAGACATCAAGAGCCGCATCAAGGAGGTCAGTGACAGGCGTGAAAGGTACAAGGTTGATAGCGTTGCGCCCAAGCCCACCGGCACAAGTACTGATACACTTCGCCAGTTAGCCTTGTTCAAAAAGGCGGAAGAGCTTATTGGCACCAAAGAAAAGAGCCTTGACATAGTCAAGATGCTGACGGAAGGAGATGAGGTCTTCAAGAAACATCTTAAGATGGTCTCTATTGTTGGCTTTGGAGGCTTAGGGAAGACAACTCTTGCTAACGTGGTATATGAGAAGCTTCGCGGGGACTTTGATTGTGCAGCTTTTGTCTCTGTGTCTCTTAATCCTGACATGAAGAAGCTTTTCAAGTGTTTGCTCCATCAGCTTGACAAGGGCGAGTACAAGAACATCATGGACGAGTCAGCGTGGAGCGAAACACAACTCATAAGTGAGATAAGAGATTTCCTTCGAGACAAGAGGTACTTCATTCTCATTGATGACATATGGGATAAATCTGTGTGGAATAATATTAGATGTGCTCTGATTGAGAATGAATGTGGTAGTAGAGTAATCGCAACAACTCGCATTCTAGATGTTGCCAAAGAAGTTGGTGGTGTTTATCAGCTTAAACCTCTTTCTACTAGTGACTCAGGACAATTATTCTATCAAAGAATATTTGGAATTGGCGACAAGCGTCCTCCTATTCAGTTGGCTGAAGTAAGTGAGAAAATTTTAGGGAAATGTGGCGGAGTACCATTAGCTATCATTACACTGGCTAGTATGTTGGCTGGTAAAAAGGAACATGAAAATACATATACTTATTGGTACAAGGTGTACCAATCTATGGGTTCTGGGCTAGAAAATAATCCTGGCCTGATGGACATGAGGAGGATACTACATGTCAGTTACTATGACCTACCTCCAAATCTGAAGACTTGTTTACTGTATCTCAGTTTGTATCCAGAGGATTATAATATTGAAACCAAAGAGTTGATATGGAAATGGATAGGCGAAGGATTCATTCATGAAGAGCAAGGGAAGAGCTTGTATGAAGTAGGAGAGGATTACATTGCTGAGCTCATTAACAAAAGCTTGGTCCAACCAATGTATATCAATATTGCTAATAAGGCGAGCTCTGTCCGTGTACACGACATGGTGCTTGACCTTATCACTTCCTTGTCAAATGAGGAGAACTTTCTCGCAACATTGGGTGGTCAGCAGACCAGGTCACTGCCACGTAAGATCCGTCGACTGTCTCTCCAAAGCAGTAATGAAGAGGATGTCCAGCCAATGCCAACCATGAGCAGCTTGTCCCATGTGAGGTCACTTACTGTGTTCAGTAAAGACCTCAGTTTGCTGTCGGCACTTTCAGGTTTTCTTGTCCTGCGTGCATTGGATTTAAGTGGTTGTGAGGAAGTGGGTAATCATCACATGAAGGACATTTGCAATTTATTTCACTTGAGGTATCTGAGTCTAGAAGGGACATCTATCACTGAGATCCCGAAAGAGATAAGCAATCTACGGCTTCTGCAATTGCTAGTCATAAGGTCCACaaaaatgaaaaaaTTTCCATCAACCTTTGTTCAGCTAGGACAACTGGTGTTCATTGACATGGGTAATAGGGAAGTCTCTAGATTGCTTCTAAAATCAATGTCCACCTTGCCCTCCCTCTCTTCACTTGCAATCGGAATAGGAGAACTGAGAGAGGAAGACCTCCAAATACTTGGGAGCATGCCGTCTCTGCATGACCTCTCTATTGATGTAGGTTATTGGGAAAGAGGCAGAGATAAAAGGCTAGTCATTGACAGTGGTTCTCCCTTCCGGTCTCTGACAAGGTTCAGTATAAAGGGTTGCGGCTTCATTGATTTCATGTTTGCACAAGGAACCTTGCAAAAGCTCCAGATCCTGGAGTTAAGTATTTTTGGTAAGGCAATAAAAGACAGATTTGGTGATTTTCAATTTGGGCTGGAGAATCTCTCATCACTTGAGCATGTCTATGTGGACGCTCGTGGTCGTGGTATAATCCCAAGTCAAGAAGCTGAGCTGAGCGGTGCACTTGAGAAAGAGCTTGATATTAATCCCAACAAGCCCACACTGACGGTGAAGGTAACTCCACGCTGA


Protein sequences

Name Description Sequence
Ta.257 translated coding region predicted by ESTScan from UniGene Ta.257

MEVVTGAMSTLLPLLGDLLKEEYNLQKSTKGEIKFLKAELESMEAALIKISEAPLDQPPNIQVKLWARDVKDLSYEIEDGIDKFRVHLECRQQKKPHSFMGFIHKSMDMLTKGKIRHKIGIDIKDIKSRIKEVSDRRERYKVDSVAPKPTGTSTDTLRQLALFKKAEELIGTKEKSLDIVKMLTEGDEVFKKHLKMVSIVGFGGLGKTTLANVVYEKLRGDFDCAAFVSVSLNPDMKKLFKCLLHQLDKGEYKNIMDESAWSETQLISEIRDFLRDKRYFILIDDIWDKSVWNNIRCALIENECGSRVIATTRILDVAKEVGGVYQLKPLSTSDSGQLFYQRIFGIGDKRPPIQLAEVSEKILGKCGGVPLAIITLASMLAGKKEHENTYTYWYKVYQSMGSGLENNPGLMDMRRILHVSYYDLPPNLKTCLLYLSLYPEDYNIETKELIWKWIGEGFIHEEQGKSLYEVGEDYIAELINKSLVQPMYINIANKASSVRVHDMVLDLITSLSNEENFLATLGGQQTRSLPRKIRRLSLQSSNEEDVQPMPTMSSLSHVRSLTVFSKDLSLLSALSGFLVLRALDLSGCEEVGNHHMKDICNLFHLRYLSLEGTSITEIPKEISNLRLLQLLVIRSTKMKKFPSTFVQLGQLVFIDMGNREVSRLLLKSMSTLPSLSSLAIGIGELREEDLQILGSMPSLHDLSIDVGYWERGRDKRLVIDSGSPFRSLTRFSIKGCGFIDFMFAQGTLQKLQILELSIFGKAIKDRFGDFQFGLENLSSLEHVYVDARGRGIIPSQEAELSGALEKELDINPNKPTLTVKVTPR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF205
4-783 PTHR23155:SF205,OS11G0550500 PROTEIN

VTGAMSTLLPLLGDLLKEEYNLQKSTKGEIKFLKAELESMEAALIKISEAPLDQPPNIQVKLWARDVKDLSYEIEDGIDKFRVHLECRQQKKPHSFMGFIHKSMDMLTKGKIRHKIGIDIKDIKSRIKEVSDRRERYKVDSVAPKPTGTSTDTLRQLALFKKAEELIGTKEKSLDIVKMLTEGDEVFKKHLKMVSIVGFGGLGKTTLANVVYEKLRGDFDCAAFVSVSLNPDMKKLFKCLLHQLDKGEYKNIMDESAWSETQLISEIRDFLRDKRYFILIDDIWDKSVWNNIRCALIENECGSRVIATTRILDVAKEVGGVYQLKPLSTSDSGQLFYQRIFGIGDKRPPIQLAEVSEKILGKCGGVPLAIITLASMLAGKKEHENTYTYWYKVYQSMGSGLENNPGLMDMRRILHVSYYDLPPNLKTCLLYLSLYPEDYNIETKELIWKWIGEGFIHEEQGKSLYEVGEDYIAELINKSLVQPMYINIANKASSVRVHDMVLDLITSLSNEENFLATLGGQQTRSLPRKIRRLSLQSSNEEDVQPMPTMSSLSHVRSLTVFSKDLSLLSALSGFLVLRALDLSGCEEVGNHHMKDICNLFHLRYLSLEGTSITEIPKEISNLRLLQLLVIRSTKMKKFPSTFVQLGQLVFIDMGNREVSRLLLKSMSTLPSLSSLAIGIGELREEDLQILGSMPSLHDLSIDVGYWERGRDKRLVIDSGSPFRSLTRFSIKGCGFIDFMFAQGTLQKLQILELSIFGKAIKDRFGDFQFGLENLSSLEHV

HMMPanther: PTHR23155
4-783 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VTGAMSTLLPLLGDLLKEEYNLQKSTKGEIKFLKAELESMEAALIKISEAPLDQPPNIQVKLWARDVKDLSYEIEDGIDKFRVHLECRQQKKPHSFMGFIHKSMDMLTKGKIRHKIGIDIKDIKSRIKEVSDRRERYKVDSVAPKPTGTSTDTLRQLALFKKAEELIGTKEKSLDIVKMLTEGDEVFKKHLKMVSIVGFGGLGKTTLANVVYEKLRGDFDCAAFVSVSLNPDMKKLFKCLLHQLDKGEYKNIMDESAWSETQLISEIRDFLRDKRYFILIDDIWDKSVWNNIRCALIENECGSRVIATTRILDVAKEVGGVYQLKPLSTSDSGQLFYQRIFGIGDKRPPIQLAEVSEKILGKCGGVPLAIITLASMLAGKKEHENTYTYWYKVYQSMGSGLENNPGLMDMRRILHVSYYDLPPNLKTCLLYLSLYPEDYNIETKELIWKWIGEGFIHEEQGKSLYEVGEDYIAELINKSLVQPMYINIANKASSVRVHDMVLDLITSLSNEENFLATLGGQQTRSLPRKIRRLSLQSSNEEDVQPMPTMSSLSHVRSLTVFSKDLSLLSALSGFLVLRALDLSGCEEVGNHHMKDICNLFHLRYLSLEGTSITEIPKEISNLRLLQLLVIRSTKMKKFPSTFVQLGQLVFIDMGNREVSRLLLKSMSTLPSLSSLAIGIGELREEDLQILGSMPSLHDLSIDVGYWERGRDKRLVIDSGSPFRSLTRFSIKGCGFIDFMFAQGTLQKLQILELSIFGKAIKDRFGDFQFGLENLSSLEHV

superfamily: SSF52540
152-404 SSF52540

TSTDTLRQLALFKKAEELIGTKEKSLDIVKMLTEGDEVFKKHLKMVSIVGFGGLGKTTLANVVYEKLRGDFDCAAFVSVSLNPDMKKLFKCLLHQLDKGEYKNIMDESAWSETQLISEIRDFLRDKRYFILIDDIWDKSVWNNIRCALIENECGSRVIATTRILDVAKEVGGVYQLKPLSTSDSGQLFYQRIFGIGDKRPPIQLAEVSEKILGKCGGVPLAIITLASMLAGKKEHENTYTYWYKVYQSMGSGL

Gene3D: G3DSA:3.40.50.300
164-313 G3DSA:3.40.50.300

KKAEELIGTKEKSLDIVKMLTEGDEVFKKHLKMVSIVGFGGLGKTTLANVVYEKLRGDFDCAAFVSVSLNPDMKKLFKCLLHQLDKGEYKNIMDESAWSETQLISEIRDFLRDKRYFILIDDIWDKSVWNNIRCALIENECGSRVIATTR

HMMPfam: PF00931
IPR002182
182-463 NB-ARC,NBS
NB-ARC

MLTEGDEVFKKHLKMVSIVGFGGLGKTTLANVVYEKLRGDFDCAAFVSVSLNPDMKKLFKCLLHQLDKGEYKNIMDESAWSETQLISEIRDFLRDKRYFILIDDIWDKSVWNNIRCALIENECGSRVIATTRILDVAKEVGGVYQLKPLSTSDSGQLFYQRIFGIGDKRPPIQLAEVSEKILGKCGGVPLAIITLASMLAGKKEHENTYTYWYKVYQSMGSGLENNPGLMDMRRILHVSYYDLPPNLKTCLLYLSLYPEDYNIETKELIWKWIGEGFIHEEQ

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

MVSIVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
273-287 DISEASERSIST
Disease resistance protein

FLRDKRYFILIDDIW

FPrintScan: PR00364
IPR000767
366-380 DISEASERSIST
Disease resistance protein

CGGVPLAIITLASML

superfamily: SSF52058
499-786 SSF52058,LRR

RVHDMVLDLITSLSNEENFLATLGGQQTRSLPRKIRRLSLQSSNEEDVQPMPTMSSLSHVRSLTVFSKDLSLLSALSGFLVLRALDLSGCEEVGNHHMKDICNLFHLRYLSLEGTSITEIPKEISNLRLLQLLVIRSTKMKKFPSTFVQLGQLVFIDMGNREVSRLLLKSMSTLPSLSSLAIGIGELREEDLQILGSMPSLHDLSIDVGYWERGRDKRLVIDSGSPFRSLTRFSIKGCGFIDFMFAQGTLQKLQILELSIFGKAIKDRFGDFQFGLENLSSLEHVYVD

Gene3D: G3DSA:3.80.10.10
527-759 G3DSA:3.80.10.10

RSLPRKIRRLSLQSSNEEDVQPMPTMSSLSHVRSLTVFSKDLSLLSALSGFLVLRALDLSGCEEVGNHHMKDICNLFHLRYLSLEGTSITEIPKEISNLRLLQLLVIRSTKMKKFPSTFVQLGQLVFIDMGNREVSRLLLKSMSTLPSLSSLAIGIGELREEDLQILGSMPSLHDLSIDVGYWERGRDKRLVIDSGSPFRSLTRFSIKGCGFIDFMFAQGTLQKLQILELSIF

FPrintScan: PR00364
IPR000767
575-591 DISEASERSIST
Disease resistance protein

SGFLVLRALDLSGCEEV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox