PRGDB00077452 (Ta.1312)

From PRG Wiki
Jump to: navigation, search
Ta.1312
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 32128900 (BT009349)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Triticum aestivum

Comment?

Triticum aestivum clone wlm96.pk0007.e4:fis, full insert mRNA sequence

DNA Sequence

CTCCGCGCCGCCGCTGCCGCTACGCCTCTCCCCGGGAAGCCTCGCCGGCGGCCAGGTGGAAGATGGAGACAGGCGGCAAAGATGGCAACCCTTTGAAGAATTACCGTATTGGGAAGACCCTGGGGATTGGTTCGTTCGGGAAGGTCAAGATTGCCGAGCATATAAAAACTGGTCACAAGGTGGCCGTCAAGATCCTTAACCGCCGGAAAATCAAAAACATGGAGATGGAAGAGAAAGTGAAAAGAGAGATCAAGATATTAAGATTATTCATGCACCCACATATCATCCGCCTTTATGAAGTGATAGAGGCACCAGCTGATATTTATGTGGTTATGGAGTATGTTAAGTCTGGTGAATTGTTTGATTACATTGTTGAGAAAGGTAGGCTACAGGAGGAAGAGGCCCGCCGTTTCTTTCAACAGATCATATCTGGTGTTCAATATTGCCACAGGAACATGGTGGTGCACCGCGATCTAAAGCCGGAGAACCTTCTTTTGGACAATAATTGTGATGTTAAGATTGCGGATTTTGGCTTAAGTAATGTTATGCGTGACGGCCACTTTCTTAAGACAAGTTGTGGTAGCCCAAATTATGCAGCTCCGGAGGTTATATCTGGAAAACTGTACGCTGGGCCTGAAGTTGATGTATGGAGCTGCGGTGTTATTCTTTATGCTCTTCTATGTGGTACTCTTCCATTTGATGATGAGAACATACCCAACCTTTTTAAGAAAATAAAGGGTGGAATATATACCCTTCCAAGCCATTTATCAGGCCCAGCAAGGGATTTGATTCCAAGGATGCTAGTTGTTGATCCTATGAAGAGGATAACCATTCGTGAAATACGCGAGCATCCATGGTTTGAAGCTCAACTCCCACGATATTTAGCCGTGCCTCCACCAGATACTGCACAACAAGTTAAAAAGATTGATGAAGAATCTCTTGTTAAAGTTATCAGTCTGGGATTTGACAAAAACCTGCTGGTTGAATCAATTCATAATAGATTGCAAAATGAGGCAACAGTTGCATATTATTTGTTTTTGGATAATAAGAGTCGCACAACAACTGGCTATCTTGGAGCTGGGTATCAAGAAGCTATGGAATCGTCTTTCTCACCCATTACTCCAAGTGAAACACAAAGTCCAGCTCATGGAAATCGGCAACAACCATATATGGAATCTCCAGTTGGCTTGAGACCACATTTTCCAGCTGATAGGAAATGGGCTCTTGGGCTTCAGTCTCGAGCACATCCAAGAGAAGTTATGACTGAAGTGCTGAAGGCTCTGCAAGAACTGAATGTATACTGGAAAAAAATTGGACACTATAACATGAAATGTAGATGGAGTCCTCCTGGCTTTCCCGGTCAGGAGAATATGAATCATACCAATTATAACTTCAGTGCAGAGCCTATTGAAACCGACGACCTGGGTGACAAGTTAAATTTAATTAAGTTCGAACTTCAGCTTTACAAAACAAGAGATGAGAAATACCTTCTGGATTTGCAAAGGGCGAGCGGGCCGCATCTCCTCTTTCTTGATCTATGTGCCGCCTTTCTAGCTCAGCTGAGAGTCTTTTGATACCAGATGTGCCCGAGGAATGTATGTTGTATCACTCTAAAGAGATGTAAATAGCAAGCTTTCTCCAGCGGATCAAAGTCGTGGAGTATGTAGACATGCGGAGCTGTTGTGTGCTTATTTCGGCGCCTATATGCTGAATTTAGACCTGGCAGGGGCGGGCAAGTGAAGCAAGCAAGGAACTATTGCCATCAGGTTATTTCCAGCTGCCGCCAAAGGCACTAGGATATAGAAGTATTACTGATTAATCCTATATTGGCCCCTTGGGACATACTCCTACTCTACTGCTGTTTACTTGCATGTAATTTTTACTGTCTGGGTCTCCAGACCAGACCACGTACACGAATAATTTCTTCaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ta.1312 translated coding region predicted by ESTScan from UniGene Ta.1312

METGGKDGNPLKNYRIGKTLGIGSFGKVKIAEHIKTGHKVAVKILNRRKIKNMEMEEKVKREIKILRLFMHPHIIRLYEVIEAPADIYVVMEYVKSGELFDYIVEKGRLQEEEARRFFQQIISGVQYCHRNMVVHRDLKPENLLLDNNCDVKIADFGLSNVMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSGPARDLIPRMLVVDPMKRITIREIREHPWFEAQLPRYLAVPPPDTAQQVKKIDEESLVKVISLGFDKNLLVESIHNRLQNEATVAYYLFLDNKSRTTTGYLGAGYQEAMESSFSPITPSETQSPAHGNRQQPYMESPVGLRPHFPADRKWALGLQSRAHPREVMTEVLKALQELNVYWKKIGHYNMKCRWSPPGFPGQENMNHTNYNFSAEPIETDDLGDKLNLIKFELQLYKTRDEKYLLDLQRASGPHLLFLDLCAAFLAQLRVF

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
6-111 no description

KDGNPLKNYRIGKTLGIGSFGKVKIAEHIKTGHKVAVKILNRRKIKNMEMEEKVKREIKILRLFMHPHIIRLYEVIEAPADIYVVMEYVKSGELFDYIVEKGRLQE

HMMPanther: PTHR24343:SF123
6-331 SUBFAMILY NOT NAMED

KDGNPLKNYRIGKTLGIGSFGKVKIAEHIKTGHKVAVKILNRRKIKNMEMEEKVKREIKILRLFMHPHIIRLYEVIEAPADIYVVMEYVKSGELFDYIVEKGRLQEEEARRFFQQIISGVQYCHRNMVVHRDLKPENLLLDNNCDVKIADFGLSNVMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSGPARDLIPRMLVVDPMKRITIREIREHPWFEAQLPRYLAVPPPDTAQQVKKIDEESLVKVISLGFDKNLLVESIHNRLQNEATVAYYLFLDNKSR

HMMPanther: PTHR24343
6-331 FAMILY NOT NAMED,SERINE/THREONINE KINASE

KDGNPLKNYRIGKTLGIGSFGKVKIAEHIKTGHKVAVKILNRRKIKNMEMEEKVKREIKILRLFMHPHIIRLYEVIEAPADIYVVMEYVKSGELFDYIVEKGRLQEEEARRFFQQIISGVQYCHRNMVVHRDLKPENLLLDNNCDVKIADFGLSNVMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSGPARDLIPRMLVVDPMKRITIREIREHPWFEAQLPRYLAVPPPDTAQQVKKIDEESLVKVISLGFDKNLLVESIHNRLQNEATVAYYLFLDNKSR

superfamily: SSF56112
IPR011009
9-362 Protein kinase-like (PK-like)
Protein kinase-like domain

NPLKNYRIGKTLGIGSFGKVKIAEHIKTGHKVAVKILNRRKIKNMEMEEKVKREIKILRLFMHPHIIRLYEVIEAPADIYVVMEYVKSGELFDYIVEKGRLQEEEARRFFQQIISGVQYCHRNMVVHRDLKPENLLLDNNCDVKIADFGLSNVMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSGPARDLIPRMLVVDPMKRITIREIREHPWFEAQLPRYLAVPPPDTAQQVKKIDEESLVKVISLGFDKNLLVESIHNRLQNEATVAYYLFLDNKSRTTTGYLGAGYQEAMESSFSPITPSETQSPAH

HMMPfam: PF00069
IPR017442
14-266 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YRIGKTLGIGSFGKVKIAEHIKTGHKVAVKILNRRKIKNMEMEEKVKREIKILRLFMHPHIIRLYEVIEAPADIYVVMEYVKSGELFDYIVEKGRLQEEEARRFFQQIISGVQYCHRNMVVHRDLKPENLLLDNNCDVKIADFGLSNVMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSGPARDLIPRMLVVDPMKRITIREIREHPWF

ProfileScan: PS50011
IPR000719
14-266 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YRIGKTLGIGSFGKVKIAEHIKTGHKVAVKILNRRKIKNMEMEEKVKREIKILRLFMHPHIIRLYEVIEAPADIYVVMEYVKSGELFDYIVEKGRLQEEEARRFFQQIISGVQYCHRNMVVHRDLKPENLLLDNNCDVKIADFGLSNVMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSGPARDLIPRMLVVDPMKRITIREIREHPWF

HMMSmart: SM00219
IPR020635
14-266 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YRIGKTLGIGSFGKVKIAEHIKTGHKVAVKILNRRKIKNMEMEEKVKREIKILRLFMHPHIIRLYEVIEAPADIYVVMEYVKSGELFDYIVEKGRLQEEEARRFFQQIISGVQYCHRNMVVHRDLKPENLLLDNNCDVKIADFGLSNVMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSGPARDLIPRMLVVDPMKRITIREIREHPWF

HMMSmart: SM00220
IPR002290
14-266 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YRIGKTLGIGSFGKVKIAEHIKTGHKVAVKILNRRKIKNMEMEEKVKREIKILRLFMHPHIIRLYEVIEAPADIYVVMEYVKSGELFDYIVEKGRLQEEEARRFFQQIISGVQYCHRNMVVHRDLKPENLLLDNNCDVKIADFGLSNVMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSGPARDLIPRMLVVDPMKRITIREIREHPWF

PatternScan: PS00107
IPR017441
20-43 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGIGSFGKVKIAEHIKTGHKVAVK

Gene3D: G3DSA:1.10.510.10
112-292 no description

EEARRFFQQIISGVQYCHRNMVVHRDLKPENLLLDNNCDVKIADFGLSNVMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSGPARDLIPRMLVVDPMKRITIREIREHPWFEAQLPRYLAVPPPDTAQQVKKIDEES

PatternScan: PS00108
IPR008271
133-145 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDLKPENLLL

ProfileScan: PS50030
IPR015940
287-327 UBA
Ubiquitin-associated/translation elongation factor

KIDEESLVKVISLGFDKNLLVESIHNRLQNEATVAYYLFLD

ProfileScan: PS50032
IPR001772
454-502 KA1
Kinase-associated KA1

LGDKLNLIKFELQLYKTRDEKYLLDLQRASGPHLLFLDLCAAFLAQLRV

HMMPfam: PF02149
IPR001772
460-502 KA1
Kinase-associated KA1

LIKFELQLYKTRDEKYLLDLQRASGPHLLFLDLCAAFLAQLRV

Seg: seg
487-500 seg

LLFLDLCAAFLAQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox