PRGDB00077456 (Ta.1755)

From PRG Wiki
Jump to: navigation, search
Ta.1755
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 222360986 (GH722247)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

AZO2.120C02R010405 AZO2 Triticum aestivum cDNA clone AZO2120C02, mRNA sequence

DNA Sequence

AATTACTTCAATGATTATTGACTCAAGGCAGAGATTAGTAGCTTAATCAAGTACACACCTGCTTCTTGAGCAATGACCAAGCATCTCCAGGCAATAATGTGTCGACTTGGTGGTAGGGCCGTCTAGCTATCATCCCTCGAGCAACACCTTCATCCCTAGTGGTGACAATGACTCGGCTGCCTGAAGCAGCAACATTGAATGGAACTTTGAGCACACCCTCCCATGCTACATGGTCCCACACATCATCCATTACCAACAAGGTCTTGTGGCCAATCAAGGCATCCTTGAGGCTTCGGTGAAGTGTGGCCTTTGCATTTCCAGCTAGTTGGGCGTCTCCTCCGGCTTCGATGATGGCTCTTCTCAGCAGCTCAACCTCATTGAAGTTTTGGTTGACGCTCAACCATATCTTTTTGCTAAACTCACCTTCGATTGCCTCATCATTGAAGATCTTCTGAGCGAGTGTGGTCTTGCCAATCCCGCCGACACCTACAATGGCGACCACCATGATGCCATCGTTGACCTCCTTTCCTGTCTGCATGATATGGGTCACCAACGCTCTTGTGTCATCTTCGATTTTGTCCCCAACCAAAGCCGACCGGTCAAAGTCCCCTACCGTCTCCCGACTTGGATTACCATAGTGCGTGGCAAGGGCATTGCCACTACGATCCTCATAGGACATGAGATTGATGAAGCCAAAAGTGGCGCTTCGTTGCTTGATGGCGTCGAGCCTCTGGTTGAATGGCTTGACGCGGATGCTGATCT


Protein sequences

Name Description Sequence
Ta.1755 translated coding region predicted by ESTScan from UniGene Ta.1755

XISIRVKPFNQRLDAIKQRSATFGFINLMSYEDRSGNALATHYGNPSRETVGDFDRSALVGDKIEDDTRALVTHIMQTGKEVNDGIMVVAIVGVGGIGKTTLAQKIFNDEAIEGEFSKKIWLSVNQNFNEVELLRRAIIEAGGDAQLAGNAKATLHRSLKDALIGHKTLLVMDDVWDHVAWEGVLKVPFNVAASGSRVIVTTRDEGVARGMIARRPYHQVDTLLPGDAWSLLKKQVCT

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
2-182 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ISIRVKPFNQRLDAIKQRSATFGFINLMSYEDRSGNALATHYGNPSRETVGDFDRSALVGDKIEDDTRALVTHIMQTGKEVNDGIMVVAIVGVGGIGKTTLAQKIFNDEAIEGEFSKKIWLSVNQNFNEVELLRRAIIEAGGDAQLAGNAKATLHRSLKDALIGHKTLLVMDDVWDHVAWE

HMMPanther: PTHR23155
2-182 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ISIRVKPFNQRLDAIKQRSATFGFINLMSYEDRSGNALATHYGNPSRETVGDFDRSALVGDKIEDDTRALVTHIMQTGKEVNDGIMVVAIVGVGGIGKTTLAQKIFNDEAIEGEFSKKIWLSVNQNFNEVELLRRAIIEAGGDAQLAGNAKATLHRSLKDALIGHKTLLVMDDVWDHVAWE

superfamily: SSF52540
42-238 P-loop containing nucleoside triphosphate hydrolases

HYGNPSRETVGDFDRSALVGDKIEDDTRALVTHIMQTGKEVNDGIMVVAIVGVGGIGKTTLAQKIFNDEAIEGEFSKKIWLSVNQNFNEVELLRRAIIEAGGDAQLAGNAKATLHRSLKDALIGHKTLLVMDDVWDHVAWEGVLKVPFNVAASGSRVIVTTRDEGVARGMIARRPYHQVDTLLPGDAWSLLKKQVCT

Gene3D: G3DSA:3.40.50.300
66-178 no description

DDTRALVTHIMQTGKEVNDGIMVVAIVGVGGIGKTTLAQKIFNDEAIEGEFSKKIWLSVNQNFNEVELLRRAIIEAGGDAQLAGNAKATLHRSLKDALIGHKTLLVMDDVWDH

HMMPfam: PF00931
IPR002182
72-236 NB-ARC,NBS
NB-ARC

VTHIMQTGKEVNDGIMVVAIVGVGGIGKTTLAQKIFNDEAIEGEFSKKIWLSVNQNFNEVELLRRAIIEAGGDAQLAGNAKATLHRSLKDALIGHKTLLVMDDVWDHVAWEGVLKVPFNVAASGSRVIVTTRDEGVARGMIARRPYHQVDTLLPGDAWSLLKKQV

Seg: seg
85-98 seg

GIMVVAIVGVGGIG

FPrintScan: PR00364
IPR000767
88-103 DISEASERSIST
Disease resistance protein

VVAIVGVGGIGKTTLA

FPrintScan: PR00364
IPR000767
162-176 DISEASERSIST
Disease resistance protein

ALIGHKTLLVMDDVW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox