PRGDB00077457 (Ta.1837)

From PRG Wiki
Jump to: navigation, search
Ta.1837
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 222365177 (GH723559)
Gene Class Mlo-like
Domain Type MLO
Gene Species Triticum aestivum

Comment?

AZO4.102A18R011126 AZO4 Triticum aestivum cDNA clone AZO4102A18, mRNA sequence

DNA Sequence

GTCTTGAACACATAAATAACTAGCATTATCAAAAGATATTTTTGGCCTCTAAAACATATATATTTACAATTGTCGAAATTGTTACTATATGACCCTTTGTAAAGCAATCAATGTACACAATTATAATAGCCTAGCGGTCCCTTGCTCCACTGATGAGTTGGCATGTGTATTTGTCATTTGAACTGCGCCACCATTTGCCTCGTCAATTGGCTCTGTAGTAATTTTATTTGGGTTTCTTGTGCGCCTCCGAGCCTTTTCAGCCCAGTTGACAAGGCCTTCAGTCACATTGTCATCAAATATAGTCTTCTTGAAAGAAGTACCCATATGAGAGACGATAGCATATAGTGGTAGGGTGCTGTAACCACAAAGGAGTTGGCAGATTACGCTTATGACAATTCGAGTAATAACATATGCTGGTTTCCCCATGATGCATGATTTAAAACCGTATGTCACCAAGAGCCAGAAGAAAAATGCAATTTCAAATGCATTCTGAAACAGGACGACGTGGATCAACAGAAGGACTAATTTAGGCCGGTGGAACCAGAAGAAGTCATCTGAAGGGGCAACTACTAAATCTCCTCGAATAGCTGTATGCTTCTGGGCAACCTCATAAGCCAATTCCGTAATGATGTGCTCCATCTTACTTCCTACCACAAGTAGCATAATGAATGGAACCAAGGTTTTATCCAAATGTAGACATACCACCCTTGAAACATTCAATAGTAGGAATATCATCAGCATGGCCCCAAGGTACCAACTGATACCGAC


Protein sequences

Name Description Sequence
Ta.1837 translated coding region predicted by ESTScan from UniGene Ta.1837

VGISWYLGAMLMIFLLLNVSRVVCLHLDKTLVPFIMLLVVGSKMEHIITELAYEVAQKHTAIRGDLVVAPSDDFFWFHRPKLVLLLIHVVLFQNAFEIAFFFWLLVTYGFKSCIMGKPAYVITRIVISVICQLLCGYSTLPLYAIVSHMGTSFKKTIFDDNVTEGLVNWAEKARRRTRNPNKITTEPIDEANGGAVQMTNTHANSSVEQGTARLL

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
1-205 Mlo
Mlo-related protein

VGISWYLGAMLMIFLLLNVSRVVCLHLDKTLVPFIMLLVVGSKMEHIITELAYEVAQKHTAIRGDLVVAPSDDFFWFHRPKLVLLLIHVVLFQNAFEIAFFFWLLVTYGFKSCIMGKPAYVITRIVISVICQLLCGYSTLPLYAIVSHMGTSFKKTIFDDNVTEGLVNWAEKARRRTRNPNKITTEPIDEANGGAVQMTNTHANS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox