PRGDB00077472 (Ta.4821)

From PRG Wiki
Jump to: navigation, search
Ta.4821
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241988466 (AK335724)
Gene Class N
Domain Type NBS
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: WT013_J24, cultivar: Chinese Spring

DNA Sequence

GGTCTCCCGTGTTCTCACTTTCCCCGCTTCCCAACTCTGACTCGCAAGCGCAAGCCACCACCTTCCCTCCTCCGTCCCGTCCCGTCCCAACGGATTCCCACGCCCTACAAAACCCCCGTCGTCCCAGCTTCCCTCCCAGCACCAGCAGCAGTCCCACCTCACCCGAATAAGCATAAACGCGCCTGAGAAAAGCCCTTGGAAATCACGCCGACGGTGGGGGGTTAGGGGAGATGGACGCGACGGCGGAAATCCACAAGGTCGCCAGCATGCGGCGCGACAGCGGCTCCATATGGCGGCGCGGCGACGACGTGTTCTCGCGATCGTCCAGGGACGAGGACGACGAGGAGGCGCTGCGCTGGGCCGCGCTCGAGAAGCTGCCCACCTACGACCGCGTCCGCCGTGCCATCCTCCCGCCTCTCGAcggcggcgagggcgcggcccccggggcggcggcggggaagggggTCGTGGACGTGCACGGCCTCGGGCCGCGCGAGCGCCGGGCTCTCCTCGAGCGCCTCGTGCGCGTCGCCGACGAGGACAACGAGCGCTTCCTGCTCAAGCTCAAGGACCGCCTCGAACGGGTTGGGATTGAAATGCCGACGATCGAGGTGCGGTTCGAGCACCTGGTGGCGGAGGCGGAGGTCCGGGTCGGCAACAGCGGCCTCCCCACCGTCCTCAACTCCATCACCAACACGCTCGAGGAAGCGGCGAACGCGCTGCGCATACTCCCCAACAGGAAGCGGACCATGCCCATCCTCCACGACGTCAGTGGCATCATCAAGCCCCGCAGGATGACACTCCTGTTGGGCCCACCTGGGTCAGGCAAGACCACCTTGCTGCTCGCCTTGGCCGGGAGGCTCGACAAAGACCTCAAGGTCTCAGGCAATGTTACCTACAACGGGCACGGGATGGAGGAGTTTGTGCCGGAGAGGACGGCGGCGTACATAAGCCAGCACGACCTCCACATAGGGGAGATGACTGTGAGGGAGACACTCGCCTTCTCCGCACGCTGCCAGGGTGTTGGCACTCGCTTTGATATGCTGACTGAGTTGTCGAGGCGAGAGAAGGCCGCAAATATCAAGCCAGATGCTGATATTGATGCATTTATGAAGGCTTCTTCAATGGGAGGTCTGGAGGCCAATGTGAACACAGACTATATACTGAAGATATTAGGACTAGAGATGTGTGCAGACACGATGGTTGGGGACGAGATGCTCAGGGGCATCTCTGGTGGACAACGGAAGCGTGTTACAACTGGTGAGATGCTGGTTGGGCCGGCCAAGGCGCTCTTCATGGACGAGATCTCAACTGGGCTCGACAGCTCAACTACATTTCAGATTGTAAACTCACTCAGGCAATCTGTGCACATCCTTGGTGGCACAGCCGTCATCTCCCTGCTGCAGCCAGCCCCTGAAACGTACAACTTATTCGATGACATCATCCTCCTCTCTGATGGCCAAGTCGTGTACCAGGGCCCTCGTGACGACGTGCTTGAATTCTTCGAGTCTGTGGGGTTCAAGTGTCCTGAAAGGAAGGGCGTCGCCGACTTCTTGCAAGAGGTGACTTCGAAGAAAGATCAAAAGCAATACTGGGTGCGGGGTGATGAGTCCTACCGGTTCGTGCCGGTTAAGGACTTTGTGCGTGCATTCCAGTCATTCCACACCGGGAGAGCTATAAGAAAGGAGCTCGCTGTGCCATTCGACAAGAGCAAGAGCCATCCAGCAGCATTGACAACTACGAGGTATGGTGTGAGTGGCACGGAGCTGCTAAAGGCAAACATTGGCAGGGAGATCCTCCTCATGAAAAGGAACTCTTTCGTCTACATGTTTAGAACCTTCCAGCTGATCCTCATGTCATTTATTGCAATGACGCTCTTCTTCCGTACAAAGATGAAGCGCGACTCGGTGACAAATGGGGGCATCTACATGGGGGCACTCTTCTTTGGTGTGCTCATGATCATGTTCAATGGCTTCTCTGAGCTTGCACTCACCGTCTTTAAGCTACCCGTGTTCTTCAAGCAGAGGGACCTCCTTTTCTACCCAGCATGGGCTTACACAATACCCTCATGGATCCTCAAGATCCCAATAACATTTGTTGAGGTTGGCGGTTATGTTTTCATAACATACTATGTCATGGGGTTCGACCCAAATGTAGGCAGGTTCTTCAAGCAATATCTTCTTATGTTAGCAATCAATCAGATGGCGGCATCACTCTTCCGATTCATTGGTGGAGCAGCAAGGAACATGATTGTTGCGAATGTCTTTGCATCATTCATGCTGCTCATTTTTATGGTATTGGGCGGATTCATTCTAGTAAGAGAAAAAGTGAAGAAATGGTGGATTTGGGGCTACTGGATCTCCCCACTAATGTATGCACAGAATGCCATCTCAGTGAATGAGTTCTTCGGTCACAGCTGGGATAAAATATTGAATAGCACGGCCTCAAACGAGACCCTTGGAGTGCAAGTCCTGAAGTATCGCGGAGTGTTTCCAGAAGCAAAGTGGTACTGGATCGGTTTGGGTGCAATGCTCGGGTACACCTTGTTGTTCAATGCTCTCTTCACTCTTGCCCTTACATACCTGAAGGCATACGGTAACTCCCGTTCGTCGGTATCTGAAGACGAACTGAAGGAGAAGCATGCCAACCTGAACGGTGAGGTTCTGGACAATGATCGCATGTTATCACCAAGCAATGATGGACCGATACGAATGAACACTGGAAATGACTCAGCAATAGTCGAAGAGAATTCTAGCCCCATGCAAAGGGGAATGGTGCTTCCATTTCTCCCGCTTTCACTCACCTTTGACAACATCAGATACTCTGTTGACATGCCACTGGAAATGAAAGCACAAGGCGTAGTTGAAGACCGATTGGAGCTCCTCAAAGGTGTTAGTGGATCTTTCAGGCCAGGGGTACTGACTGCCCTGATGGGTGTCAGTGGTGCTGGCAAGACTACTCTGATGGATGTGTTGGCAGGGAGAAAGACAGGTGGGTACATTCAAGGAAACATCAGCATTTCAGGATACCCGAAGAAACAAGAGACCTTTGCACGCGTATCAGGATACTGCGAACAGAATGATATCCACTCTCCGCAGGTGACAGTCTATGAGTCGCTGCTTTTCTCAGCATGGCTCCGTCTCCCCGAGGATGTTGATTCAAACAAAAGAAGGATGTTCATCGAGGAGGTGATGGAGCTTGTGGAGCTCAAGCCTCTGAAAGATGCATTGGTTGGTCTACCGGGAGTGAATGGTCTGTCAACTGAACAGAGGAAGAGGCTGACCATTGCTGTGGAGCTCGTTGCTAATCCTTCTATCATTTTCATGGATGAGCCAACCTCCGGACTTGATGCCCGAGCAGCCGCAATCGTGATGAGGACAGTGAGGAACACTGTTGATACTGGTAGAACTGTGGTTTGCACGATTCATCAACCTAGCATTGACATATTTGAAGCATTTGATGAGCTATTCCTGATGAAGCGAGGTGGAGAAGAGATCTATGCTGGTCCATTGGGCCATCATTCTGCAGACTTAATCAATTACTATGAGGGCATTCATGGGGTCAGCAAAATTAAAGATGGCTACAATCCGGCAACATGGATGTTGGAAGTGACAACGATCGGTCAAGAACAGATGCTAGGCATTGATTTCAGTGACATATACAAGAAATCTGAACTCTACCAGAGAAACAAGGCATTGATAAAGGAACAGAGCCAACCCGCGCCGGGTTCAACTGATCTGTATTTCCCTACCCAGTACTCGCAGTCTTCGATCACACAATGCATGGCTTGCCTGTGGAAGCAGAACCTGTCATACTGGAGGAACCCTCCTTACAATGCCGTTAGGTTCCTTTTCACTACTGTGATTGCTCTCCTCTTCGGCACCATCTTCTGGGACCTTGGTGGCAAAATGAGCCAGTCACAAGACTTGTTCAACGCCATGGGGTCAATGTATGCTGCAGTGCTGTTCATTGGTATTATGAACTGTACTTCGGTTCAACCAGTGGTGGCTGTGGAGAGGACAGTCTTTTACCGTGAAAGAGCAGCCGGCATGTACTCAGCATTCCCGTACGCATTTGGCCAGGTTGTCATTGAACTCCCATACACACTCGCTCAGGCTACCGTATACGGAGTCATAGTTTACTCGATGATTGGGTTTGAGTGGACAGCTCCTAAATTCTTCTGGTACCTCTTCTTCATGTACTTCACGCTGCTCTACTTCACATTCTACGGCATGATGGCTGTTGGCCTGACACCCAACTACCACATCGCCTCAATCGTCTCGTCAGCATTCTACGCCATCTGGAATCTCTTCTCAGGATTCATCATCCCCCGACCAAAAGTTCCAATCTGGTGGAGATGGTATTGCTGGGTATGCCCCGTAGCGTGGACACTGTACGGGCTGGTTGTCTCACAGTTTGGCGATGTCACAACGCCAATGGAGGACGGCACTCCCGTGAAAGACTTTATAGAGGGCTACTTCGACTTCAAGCACAGCTGGTTAGGTTATGTTGCTACGGTGGTCGTGGCGTTTGCGGTGCTGTTTGCCTTCTTGTTCGGTTTTGCCATCATGAAGCTCAACTTCCAGAAGAGGTAGATGATGACGATATGAGGCATGTTCTAGAAAGAAATGCATTAGTTGCCCGCAAATATGAATCGATGTGTACATATCATTTGACCACATGGAATGTTTAGGTTCATTAGTTATCTTGTACTAGTACATCATAGAGGTCTATCTTTTGGAAACATTTTGCACCaaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.4821 translated coding region predicted by ESTScan from UniGene Ta.4821

GLPCSHFPRFPTLTRKRKPPPSLLRPVPSQRIPTPYKTPVVPASLPAPAAVPPHPNKHKRAXRKALGNHADGGGLGEMDATAEIHKVASMRRDSGSIWRRGDDVFSRSSRDEDDEEALRWAALEKLPTYDRVRRAILPPLDGGEGAAPGAAAGKGVVDVHGLGPRERRALLERLVRVADEDNERFLLKLKDRLERVGIEMPTIEVRFEHLVAEAEVRVGNSGLPTVLNSITNTLEEAANALRILPNRKRTMPILHDVSGIIKPRRMTLLLGPPGSGKTTLLLALAGRLDKDLKVSGNVTYNGHGMEEFVPERTAAYISQHDLHIGEMTVRETLAFSARCQGVGTRFDMLTELSRREKAANIKPDADIDAFMKASSMGGLEANVNTDYILKILGLEMCADTMVGDEMLRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNSLRQSVHILGGTAVISLLQPAPETYNLFDDIILLSDGQVVYQGPRDDVLEFFESVGFKCPERKGVADFLQEVTSKKDQKQYWVRGDESYRFVPVKDFVRAFQSFHTGRAIRKELAVPFDKSKSHPAALTTTRYGVSGTELLKANIGREILLMKRNSFVYMFRTFQLILMSFIAMTLFFRTKMKRDSVTNGGIYMGALFFGVLMIMFNGFSELALTVFKLPVFFKQRDLLFYPAWAYTIPSWILKIPITFVEVGGYVFITYYVMGFDPNVGRFFKQYLLMLAINQMAASLFRFIGGAARNMIVANVFASFMLLIFMVLGGFILVREKVKKWWIWGYWISPLMYAQNAISVNEFFGHSWDKILNSTASNETLGVQVLKYRGVFPEAKWYWIGLGAMLGYTLLFNALFTLALTYLKAYGNSRSSVSEDELKEKHANLNGEVLDNDRMLSPSNDGPIRMNTGNDSAIVEENSSPMQRGMVLPFLPLSLTFDNIRYSVDMPLEMKAQGVVEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIQGNISISGYPKKQETFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPEDVDSNKRRMFIEEVMELVELKPLKDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYAGPLGHHSADLINYYEGIHGVSKIKDGYNPATWMLEVTTIGQEQMLGIDFSDIYKKSELYQRNKALIKEQSQPAPGSTDLYFPTQYSQSSITQCMACLWKQNLSYWRNPPYNAVRFLFTTVIALLFGTIFWDLGGKMSQSQDLFNAMGSMYAAVLFIGIMNCTSVQPVVAVERTVFYRERAAGMYSAFPYAFGQVVIELPYTLAQATVYGVIVYSMIGFEWTAPKFFWYLFFMYFTLLYFTFYGMMAVGLTPNYHIASIVSSAFYAIWNLFSGFIIPRPKVPIWWRWYCWVCPVAWTLYGLVVSQFGDVTTPMEDGTPVKDFIEGYFDFKHSWLGYVATVVVAFAVLFAFLFGFAIMKLNFQKR

Domains

Domain Start-End Description Sequence

Seg: seg
16-29 seg

KRKPPPSLLRPVPS

Seg: seg
39-55 seg

PVVPASLPAPAAVPPHP

Seg: seg
142-155 seg

GGEGAAPGAAAGKG

Seg: seg
165-178 seg

RERRALLERLVRVA

ProfileScan: PS50893
IPR003439
235-511 ABC_TRANSPORTER_2
ABC transporter-like

EEAANALRILPNRKRTMPILHDVSGIIKPRRMTLLLGPPGSGKTTLLLALAGRLDKDLKVSGNVTYNGHGMEEFVPERTAAYISQHDLHIGEMTVRETLAFSARCQGVGTRFDMLTELSRREKAANIKPDADIDAFMKASSMGGLEANVNTDYILKILGLEMCADTMVGDEMLRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNSLRQSVHILGGTAVISLLQPAPETYNLFDDIILLSDGQVVYQGPRDDVLEFFESVGFKCPE

superfamily: SSF52540
251-515 P-loop containing nucleoside triphosphate hydrolases

MPILHDVSGIIKPRRMTLLLGPPGSGKTTLLLALAGRLDKDLKVSGNVTYNGHGMEEFVPERTAAYISQHDLHIGEMTVRETLAFSARCQGVGTRFDMLTELSRREKAANIKPDADIDAFMKASSMGGLEANVNTDYILKILGLEMCADTMVGDEMLRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNSLRQSVHILGGTAVISLLQPAPETYNLFDDIILLSDGQVVYQGPRDDVLEFFESVGFKCPERKGV

Gene3D: G3DSA:3.40.50.300
251-500 no description

MPILHDVSGIIKPRRMTLLLGPPGSGKTTLLLALAGRLDKDLKVSGNVTYNGHGMEEFVPERTAAYISQHDLHIGEMTVRETLAFSARCQGVGTRFDMLTELSRREKAANIKPDADIDAFMKASSMGGLEANVNTDYILKILGLEMCADTMVGDEMLRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNSLRQSVHILGGTAVISLLQPAPETYNLFDDIILLSDGQVVYQGPRDDVLE

HMMSmart: SM00382
IPR003593
263-488 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PRRMTLLLGPPGSGKTTLLLALAGRLDKDLKVSGNVTYNGHGMEEFVPERTAAYISQHDLHIGEMTVRETLAFSARCQGVGTRFDMLTELSRREKAANIKPDADIDAFMKASSMGGLEANVNTDYILKILGLEMCADTMVGDEMLRGISGGQRKRVTTGEMLVGPAKALFMDEISTGLDSSTTFQIVNSLRQSVHILGGTAVISLLQPAPETYNLFDDIILLSDGQ

HMMPfam: PF00005
IPR003439
278-435 ABC_tran
ABC transporter-like

TTLLLALAGRLDKDLKVSGNVTYNGHGMEEFVPERTAAYISQHDLHIGEMTVRETLAFSARCQGVGTRFDMLTELSRREKAANIKPDADIDAFMKASSMGGLEANVNTDYILKILGLEMCADTMVGDEMLRGISGGQRKRVTTGEMLVGPAKALFMDE

HMMPanther: PTHR19241:SF10
439-1531 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

GLDSSTTFQIVNSLRQSVHILGGTAVISLLQPAPETYNLFDDIILLSDGQVVYQGPRDDVLEFFESVGFKCPERKGVADFLQEVTSKKDQKQYWVRGDESYRFVPVKDFVRAFQSFHTGRAIRKELAVPFDKSKSHPAALTTTRYGVSGTELLKANIGREILLMKRNSFVYMFRTFQLILMSFIAMTLFFRTKMKRDSVTNGGIYMGALFFGVLMIMFNGFSELALTVFKLPVFFKQRDLLFYPAWAYTIPSWILKIPITFVEVGGYVFITYYVMGFDPNVGRFFKQYLLMLAINQMAASLFRFIGGAARNMIVANVFASFMLLIFMVLGGFILVREKVKKWWIWGYWISPLMYAQNAISVNEFFGHSWDKILNSTASNETLGVQVLKYRGVFPEAKWYWIGLGAMLGYTLLFNALFTLALTYLKAYGNSRSSVSEDELKEKHANLNGEVLDNDRMLSPSNDGPIRMNTGNDSAIVEENSSPMQRGMVLPFLPLSLTFDNIRYSVDMPLEMKAQGVVEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIQGNISISGYPKKQETFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPEDVDSNKRRMFIEEVMELVELKPLKDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYAGPLGHHSADLINYYEGIHGVSKIKDGYNPATWMLEVTTIGQEQMLGIDFSDIYKKSELYQRNKALIKEQSQPAPGSTDLYFPTQYSQSSITQCMACLWKQNLSYWRNPPYNAVRFLFTTVIALLFGTIFWDLGGKMSQSQDLFNAMGSMYAAVLFIGIMNCTSVQPVVAVERTVFYRERAAGMYSAFPYAFGQVVIELPYTLAQATVYGVIVYSMIGFEWTAPKFFWYLFFMYFTLLYFTFYGMMAVGLTPNYHIASIVSSAFYAIWNLFSGFIIPRPKVPIWWRWYCWVCPVAWTLYGLVVSQFGDVTTPMEDGTPVKDFIEGYFDFKHSWLGYVATVVVAFAVLFAFLFGFAIMKLNFQKR

HMMPanther: PTHR19241
439-1531 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

GLDSSTTFQIVNSLRQSVHILGGTAVISLLQPAPETYNLFDDIILLSDGQVVYQGPRDDVLEFFESVGFKCPERKGVADFLQEVTSKKDQKQYWVRGDESYRFVPVKDFVRAFQSFHTGRAIRKELAVPFDKSKSHPAALTTTRYGVSGTELLKANIGREILLMKRNSFVYMFRTFQLILMSFIAMTLFFRTKMKRDSVTNGGIYMGALFFGVLMIMFNGFSELALTVFKLPVFFKQRDLLFYPAWAYTIPSWILKIPITFVEVGGYVFITYYVMGFDPNVGRFFKQYLLMLAINQMAASLFRFIGGAARNMIVANVFASFMLLIFMVLGGFILVREKVKKWWIWGYWISPLMYAQNAISVNEFFGHSWDKILNSTASNETLGVQVLKYRGVFPEAKWYWIGLGAMLGYTLLFNALFTLALTYLKAYGNSRSSVSEDELKEKHANLNGEVLDNDRMLSPSNDGPIRMNTGNDSAIVEENSSPMQRGMVLPFLPLSLTFDNIRYSVDMPLEMKAQGVVEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIQGNISISGYPKKQETFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPEDVDSNKRRMFIEEVMELVELKPLKDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYAGPLGHHSADLINYYEGIHGVSKIKDGYNPATWMLEVTTIGQEQMLGIDFSDIYKKSELYQRNKALIKEQSQPAPGSTDLYFPTQYSQSSITQCMACLWKQNLSYWRNPPYNAVRFLFTTVIALLFGTIFWDLGGKMSQSQDLFNAMGSMYAAVLFIGIMNCTSVQPVVAVERTVFYRERAAGMYSAFPYAFGQVVIELPYTLAQATVYGVIVYSMIGFEWTAPKFFWYLFFMYFTLLYFTFYGMMAVGLTPNYHIASIVSSAFYAIWNLFSGFIIPRPKVPIWWRWYCWVCPVAWTLYGLVVSQFGDVTTPMEDGTPVKDFIEGYFDFKHSWLGYVATVVVAFAVLFAFLFGFAIMKLNFQKR

HMMPfam: PF01061
IPR013525
590-802 ABC2_membrane
ABC-2 type transporter

LLKANIGREILLMKRNSFVYMFRTFQLILMSFIAMTLFFRTKMKRDSVTNGGIYMGALFFGVLMIMFNGFSELALTVFKLPVFFKQRDLLFYPAWAYTIPSWILKIPITFVEVGGYVFITYYVMGFDPNVGRFFKQYLLMLAINQMAASLFRFIGGAARNMIVANVFASFMLLIFMVLGGFILVREKVKKWWIWGYWISPLMYAQNAISVNEF

HMMPfam: PF08370
IPR013581
807-873 PDR_assoc
Plant PDR ABC transporter associated

WDKILNSTASNETLGVQVLKYRGVFPEAKWYWIGLGAMLGYTLLFNALFTLALTYLKAYGNSRSSVS

Seg: seg
847-862 seg

YTLLFNALFTLALTYL

superfamily: SSF52540
926-1173 P-loop containing nucleoside triphosphate hydrolases

VLPFLPLSLTFDNIRYSVDMPLEMKAQGVVEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIQGNISISGYPKKQETFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPEDVDSNKRRMFIEEVMELVELKPLKDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYAGPLGH

ProfileScan: PS50893
IPR003439
934-1186 ABC_TRANSPORTER_2
ABC transporter-like

LTFDNIRYSVDMPLEMKAQGVVEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIQGNISISGYPKKQETFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPEDVDSNKRRMFIEEVMELVELKPLKDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYAGPLGHHSADLINYYEGIH

Gene3D: G3DSA:3.40.50.300
935-1170 no description

TFDNIRYSVDMPLEMKAQGVVEDRLELLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIQGNISISGYPKKQETFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPEDVDSNKRRMFIEEVMELVELKPLKDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYAGP

HMMSmart: SM00382
IPR003593
971-1163 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGVLTALMGVSGAGKTTLMDVLAGRKTGGYIQGNISISGYPKKQETFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPEDVDSNKRRMFIEEVMELVELKPLKDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGG

HMMPfam: PF00005
IPR003439
986-1114 ABC_tran
ABC transporter-like

TTLMDVLAGRKTGGYIQGNISISGYPKKQETFARVSGYCEQNDIHSPQVTVYESLLFSAWLRLPEDVDSNKRRMFIEEVMELVELKPLKDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS

HMMPfam: PF01061
IPR013525
1259-1473 ABC2_membrane
ABC-2 type transporter

TQCMACLWKQNLSYWRNPPYNAVRFLFTTVIALLFGTIFWDLGGKMSQSQDLFNAMGSMYAAVLFIGIMNCTSVQPVVAVERTVFYRERAAGMYSAFPYAFGQVVIELPYTLAQATVYGVIVYSMIGFEWTAPKFFWYLFFMYFTLLYFTFYGMMAVGLTPNYHIASIVSSAFYAIWNLFSGFIIPRPKVPIWWRWYCWVCPVAWTLYGLVVSQF

Seg: seg
1393-1410 seg

FFWYLFFMYFTLLYFTFY

Seg: seg
1504-1522 seg

VATVVVAFAVLFAFLFGFA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox