PRGDB00077513 (Ta.8225)

From PRG Wiki
Jump to: navigation, search
Ta.8225
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241983304 (AK331244)
Gene Class N
Domain Type NBS
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: WT007_A05, cultivar: Chinese Spring

DNA Sequence

GATAGCAGCAGCCAGCAGCTAAACACAAGCCTCACTTCACATCGCACTGCATCGCATCGACCGGCCTCTCCCTCCGAGGAGAGCTCCCGCGCGTCGCCGCCAGTGCGGGCGAGAGCCATgagaggaggaggaggtggaggaggaggagaggacacgcggaggaCGGCGGCCGGGCAGGCCATGGTGGAGCTGCAGGCCAACGGGGCGACCGCGACGTCGGCCAGCGGCGCGATGGTGGTGGGGCTGAGCCCGCTGAGCGAGACGCTGTGGCGGGACAGCAAGGCGATGCCCGGGGCGGGCGCGGCAGCGCTCATCGGCGAGGTGTCGGCGAGGCTGACGTGGAAGGACCTGTCGGTCACCGTGGCGCTGGGCCCCGGCAAGACGCAGACCGTGCTGGACGAGCTCACCGGCTTCGCCGAGCCCGGGTCGCTGACCGCGCTCATGGGCCCGTCCGGCTCCGGCAAGTCCACGCTCCTCGACGCCCTCGCCGGCCGCCTCGCCGCCAACGCCTTCCTCTCCGGCAGCGTCCTGCTCAACGGCCGCAAGGCCAAGCTCTCCTTCGGCGCCGCGGCGTACGTGACGCAGGACGACAACCTGATCGGGACGCTGACGGTGCGGGAGACGATCGGGTACTCGGCGCTGCTGCGGCTGCCGGACAAGATGCCGCGGGACGACAAGCGCGCGCTGGTGGAGGGCACCATCGTGGAGATGGGGCTGCAGGACTGCGCCGACACCGTCATCGGCAACTGGCACCTCCGGGGCGTCAGCGGCGGCGAGAAGCGCCGGGTCAGCATCGCCCTGGAGCTCCTCATGCGGCCCCGGCTCCTCTTCCTCGACGAGCCCACCAGCGGCCTCGACAGCTCCTCGGCCTTCTTCGTGACGCAGACGCTGCGGGGCCTGGCGAGGGATGGCAGGACAGTGATTGCGTCCATCCACCAGCCCAGCAGCGAGGTCTTCGAGCTGTTCGACATGCTCTTCCTGCTCTCCGGGGGCAAAAACGTCTACTTCGGACAGGCAGCGCAAGCATGTGAGTTCTTCGCTGAAGTTGGGTTCCCATGCCCACCTTTGAGAAATCCCTCGGATCATTTCCTGAGGTGCGTCAACTCCGACTTCGACAAGGTGAAGGCCACCCTGAAAGGATCAATGAAAGCAAGGATCGAAAGGTCTGATGATCCTCTGGATAAGATAACCACATCAGAGGCCATCAGGAAACTTGTCTCTGCCTACAACAGGTCGCAGTACTACTACGCTGCTAGGGAGAAAGTTAATGACATTGCGCGAATCAAAGGAACGGTGATGGATTCAAGGGGCAGCCAGGCCAGCTTCTTGATGCAGGCGTGTACACTTACCAGGCGCTCATTCATCAACATGTCGCGCGACTTTGGGTACTACTGGCTCAGGCTCTTGATCTATCTCCTCGTGACCGTCTGCATCGGCACAATCTACCTGGATGTTGGCACCAAATACACATCCATCCTGGCCAGGGCAGCATGTGCAGCATTCGTCTTTGGATTCGTTACCTTCATGTCCATTGGAGGATTCCCTTCATTCGTGGAAGAAATGAAGGTTTTCCAGCGGGAACGGTTGAATGGGCACTACGGTGTTGCAGCATTTGTGGTTGCCAACACCATCTCTGCTCTGCCATTCCTGGTCCTGATATGCTTCATGTCAGGGACAGTATGCTACTTCATGGTGCGCCTTCATCCTGGTTTCACACACTACATCTTCTTCGTCTTGAACCTCTACGCCAGTGTCACCGTGGTTGAGAGCTTGATGATGGCCATTGCAAGTGTCATACCCAATTTCCTCATGGGCATCATCATAGGAGCTGGAATTCAGGGAATATTCATGCTTGTCTCCGGATACTTCAGGCTTCCCTATGACATCCCGAAGGTTTTCTGGAGATACCCCATGCAGTACATCAGCTTCCATTACTGGGCACTACAGGGCCAATGCCAGAATGACATGGACGGTCTCCTATTCGACAACCAATACCCGGACCAGCCGAAGATCCCCGGGGAGTTCATCCTGAAGTACATCTTCCAGATCAACGTGCACCGGTCGAAGTGGATCGATCTGTCGGTCATCTTCAGCATGATCTTCATCTACCGCCTGCTGTTCTTCATCATGATCAAGGTGAACGAGGACGTGATGCCCTGGATCCGGGGCTACATCGCGAGGAAGAGGCTTCAGAAGAAGGTGCCTGCCATCGGCAAGACGCCTTCCCTGAGAGGCTATGTTGTGGATCCGGAGCTTGGTCCTAACGAAGGCTAGAAAGATATAAGCTGGGGGTTGCTGGGTAGCACAAATAGGAGGGTTTCCTACCGGTTCTTGGCGTAATATGTATCTATGATCAGAGAAACTGGTAATTTTTATACGTTTTGGAAGTGAAGCTCGTTTGAGTAGAGGTACATACACaaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.8225 translated coding region predicted by ESTScan from UniGene Ta.8225

DSSSQQLNTSLTSHRTASHRPASPSEESSRASPPVRARAMRGGGGGGGGEDTRRTAAGQAMVELQANGATATSASGAMVVGLSPLSETLWRDSKAMPGAGAAALIGEVSARLTWKDLSVTVALGPGKTQTVLDELTGFAEPGSLTALMGPSGSGKSTLLDALAGRLAANAFLSGSVLLNGRKAKLSFGAAAYVTQDDNLIGTLTVRETIGYSALLRLPDKMPRDDKRALVEGTIVEMGLQDCADTVIGNWHLRGVSGGEKRRVSIALELLMRPRLLFLDEPTSGLDSSSAFFVTQTLRGLARDGRTVIASIHQPSSEVFELFDMLFLLSGGKNVYFGQAAQACEFFAEVGFPCPPLRNPSDHFLRCVNSDFDKVKATLKGSMKARIERSDDPLDKITTSEAIRKLVSAYNRSQYYYAAREKVNDIARIKGTVMDSRGSQASFLMQACTLTRRSFINMSRDFGYYWLRLLIYLLVTVCIGTIYLDVGTKYTSILARAACAAFVFGFVTFMSIGGFPSFVEEMKVFQRERLNGHYGVAAFVVANTISALPFLVLICFMSGTVCYFMVRLHPGFTHYIFFVLNLYASVTVVESLMMAIASVIPNFLMGIIIGAGIQGIFMLVSGYFRLPYDIPKVFWRYPMQYISFHYWALQGQCQNDMDGLLFDNQYPDQPKIPGEFILKYIFQINVHRSKWIDLSVIFSMIFIYRLLFFIMIKVNEDVMPWIRGYIARKRLQKKVPAIGKTPSLRGYVVDPELGPNEGXKDISWGLLGSTNRRVSYRFLA

Domains

Domain Start-End Description Sequence

Seg: seg
2-13 seg

SSSQQLNTSLTS

Seg: seg
20-34 seg

RPASPSEESSRASPP

Seg: seg
42-49 seg

GGGGGGGG

Seg: seg
68-77 seg

GATATSASGA

HMMPanther: PTHR19241:SF20
107-727 ATP-BINDING CASSETTE TRANSPORTER PLANT,ATP-BINDING CASSETTE TRANSPORTER PLANT

EVSARLTWKDLSVTVALGPGKTQTVLDELTGFAEPGSLTALMGPSGSGKSTLLDALAGRLAANAFLSGSVLLNGRKAKLSFGAAAYVTQDDNLIGTLTVRETIGYSALLRLPDKMPRDDKRALVEGTIVEMGLQDCADTVIGNWHLRGVSGGEKRRVSIALELLMRPRLLFLDEPTSGLDSSSAFFVTQTLRGLARDGRTVIASIHQPSSEVFELFDMLFLLSGGKNVYFGQAAQACEFFAEVGFPCPPLRNPSDHFLRCVNSDFDKVKATLKGSMKARIERSDDPLDKITTSEAIRKLVSAYNRSQYYYAAREKVNDIARIKGTVMDSRGSQASFLMQACTLTRRSFINMSRDFGYYWLRLLIYLLVTVCIGTIYLDVGTKYTSILARAACAAFVFGFVTFMSIGGFPSFVEEMKVFQRERLNGHYGVAAFVVANTISALPFLVLICFMSGTVCYFMVRLHPGFTHYIFFVLNLYASVTVVESLMMAIASVIPNFLMGIIIGAGIQGIFMLVSGYFRLPYDIPKVFWRYPMQYISFHYWALQGQCQNDMDGLLFDNQYPDQPKIPGEFILKYIFQINVHRSKWIDLSVIFSMIFIYRLLFFIMIKVNEDVMPWIRGYIAR

HMMPanther: PTHR19241
107-727 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

EVSARLTWKDLSVTVALGPGKTQTVLDELTGFAEPGSLTALMGPSGSGKSTLLDALAGRLAANAFLSGSVLLNGRKAKLSFGAAAYVTQDDNLIGTLTVRETIGYSALLRLPDKMPRDDKRALVEGTIVEMGLQDCADTVIGNWHLRGVSGGEKRRVSIALELLMRPRLLFLDEPTSGLDSSSAFFVTQTLRGLARDGRTVIASIHQPSSEVFELFDMLFLLSGGKNVYFGQAAQACEFFAEVGFPCPPLRNPSDHFLRCVNSDFDKVKATLKGSMKARIERSDDPLDKITTSEAIRKLVSAYNRSQYYYAAREKVNDIARIKGTVMDSRGSQASFLMQACTLTRRSFINMSRDFGYYWLRLLIYLLVTVCIGTIYLDVGTKYTSILARAACAAFVFGFVTFMSIGGFPSFVEEMKVFQRERLNGHYGVAAFVVANTISALPFLVLICFMSGTVCYFMVRLHPGFTHYIFFVLNLYASVTVVESLMMAIASVIPNFLMGIIIGAGIQGIFMLVSGYFRLPYDIPKVFWRYPMQYISFHYWALQGQCQNDMDGLLFDNQYPDQPKIPGEFILKYIFQINVHRSKWIDLSVIFSMIFIYRLLFFIMIKVNEDVMPWIRGYIAR

Gene3D: G3DSA:3.40.50.300
111-342 no description

RLTWKDLSVTVALGPGKTQTVLDELTGFAEPGSLTALMGPSGSGKSTLLDALAGRLAANAFLSGSVLLNGRKAKLSFGAAAYVTQDDNLIGTLTVRETIGYSALLRLPDKMPRDDKRALVEGTIVEMGLQDCADTVIGNWHLRGVSGGEKRRVSIALELLMRPRLLFLDEPTSGLDSSSAFFVTQTLRGLARDGRTVIASIHQPSSEVFELFDMLFLLSGGKNVYFGQAAQA

superfamily: SSF52540
112-341 P-loop containing nucleoside triphosphate hydrolases

LTWKDLSVTVALGPGKTQTVLDELTGFAEPGSLTALMGPSGSGKSTLLDALAGRLAANAFLSGSVLLNGRKAKLSFGAAAYVTQDDNLIGTLTVRETIGYSALLRLPDKMPRDDKRALVEGTIVEMGLQDCADTVIGNWHLRGVSGGEKRRVSIALELLMRPRLLFLDEPTSGLDSSSAFFVTQTLRGLARDGRTVIASIHQPSSEVFELFDMLFLLSGGKNVYFGQAAQ

ProfileScan: PS50893
IPR003439
112-355 ABC_TRANSPORTER_2
ABC transporter-like

LTWKDLSVTVALGPGKTQTVLDELTGFAEPGSLTALMGPSGSGKSTLLDALAGRLAANAFLSGSVLLNGRKAKLSFGAAAYVTQDDNLIGTLTVRETIGYSALLRLPDKMPRDDKRALVEGTIVEMGLQDCADTVIGNWHLRGVSGGEKRRVSIALELLMRPRLLFLDEPTSGLDSSSAFFVTQTLRGLARDGRTVIASIHQPSSEVFELFDMLFLLSGGKNVYFGQAAQACEFFAEVGFPCPP

HMMSmart: SM00382
IPR003593
141-340 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGSLTALMGPSGSGKSTLLDALAGRLAANAFLSGSVLLNGRKAKLSFGAAAYVTQDDNLIGTLTVRETIGYSALLRLPDKMPRDDKRALVEGTIVEMGLQDCADTVIGNWHLRGVSGGEKRRVSIALELLMRPRLLFLDEPTSGLDSSSAFFVTQTLRGLARDGRTVIASIHQPSSEVFELFDMLFLLSGGKNVYFGQAA

HMMPfam: PF00005
IPR003439
156-283 ABC_tran
ABC transporter-like

STLLDALAGRLAANAFLSGSVLLNGRKAKLSFGAAAYVTQDDNLIGTLTVRETIGYSALLRLPDKMPRDDKRALVEGTIVEMGLQDCADTVIGNWHLRGVSGGEKRRVSIALELLMRPRLLFLDEPTS

PatternScan: PS00211
IPR017871
255-269 ABC_TRANSPORTER_1
ABC transporter, conserved site

VSGGEKRRVSIALEL

Seg: seg
267-278 seg

LELLMRPRLLFL

HMMPfam: PF01061
IPR013525
445-650 ABC2_membrane
ABC-2 type transporter

QACTLTRRSFINMSRDFGYYWLRLLIYLLVTVCIGTIYLDVGTKYTSILARAACAAFVFGFVTFMSIGGFPSFVEEMKVFQRERLNGHYGVAAFVVANTISALPFLVLICFMSGTVCYFMVRLHPGFTHYIFFVLNLYASVTVVESLMMAIASVIPNFLMGIIIGAGIQGIFMLVSGYFRLPYDIPKVFWRYPMQYISFHYWALQG

Seg: seg
605-615 seg

GIIIGAGIQGI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox