PRGDB00077531 (Ta.10505)

From PRG Wiki
Jump to: navigation, search
Ta.10505
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241987848 (AK335105)
Gene Class N
Domain Type Ser-Thr Kinase, NBS
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: WT012_B08, cultivar: Chinese Spring

DNA Sequence

ggcccctcgcccccccctccgccctcgtcgccttcgtcctcttcctcctgctgctcctcctcccCCTGCAGACTCCCAATTCCATTCGCACCCAAACCCTAAACCTAAATGGCCCTCGCCGCGAGCTCGCCGGAGGGGAATCTTCGTCGCCGGTGACCGCCGATCCGCCCGTCCCCGCCGCAGCCGGCGGCGCCCCGGGCCGCGGAGGGGCCGAATCTCCGAGGAGGAGGGACGAGATGGCGTCCCGGCAGCACAACCCGAAATCCAAGACGCTCGGCAACAAATACATGCTGGGGGACGAGATAGGGAAGGGCGCGTACGGGCGCGTCTACAAGGGGCTTGACCTGGAGAATGGCGACTTCGTGGCCATCAAGCAGGTCTCGCTGGAGAACATCCCGCAGGAGGATCTCAATATTATCATGCAAGAAATTGATCTACTGAAAAATCTCAATCACAAAAATATTGTGAAGTATCTTGGATCATTGAAGACAAATAGCCATCTTCATATCATTCTGGAATATGTGGAGAATGGTTCACTAGCCAATATTATCAAGCCAAACAAATTTGGACCATTTCCTGAATCATTAGCAGCCGTCTACATTGCTCAGGTGTTGGAGGGTCTTGTCTATCTGCATGAGCAAGGTGTCATACATAGAGATATCAAGGGTGCAAATATATTGACAACTAAAGAGGGCCTTGTTAAACTTGCTGATTTTGGAGTTGCTACTAAATTAACTGAAGCTGATGTCAACACACACTCAGTGGTTGGAACCCCATACTGGATGGCCCCCGAGGTTATTGAAATGTCTGGTGTTTGTGCCGCGTCAGATATCTGGAGTGTTGGTTGCACAGTTATTGAGCTACTCACTTGTTCCCCACCATATTATGAACTGCAGCCCATGCCTGCACTGTTTCGCATTGTTCAGGATGTGCAACCACCAATACCGGAAGGATTCTCTCCTGAGATTACTGATTTTCTCCGGCAATGTTTTCAAAAGGATTCAATACAACGGCCTGATGCAAAGACATTGTTGATGCACCCATGGTTGCAGAACTCGAGACGGGCCTCGTCATCTCCCCGACAGACTAATCCGAGGCATATTGACATGGATGATGAAGTCCCAAGTAGCGATAATCATGCTGGGTTTTCTGGTCCATCAGGAGATACACAAGCACCTGTTGCTTCTGACGTTGAACAGGAGGATGGAACAAAAGAACTGGTTTCTGTATCTGCGGGACAAGGTAAACCTGACGAGCTTCATGATGGAAAACCTGCAGAGAGCAATATTTCAAACAATGTGGAACTTATGAAAGATAATGTGGTTCTCACTAAAGATCCTACATTAGTTTTCCATGAAAAGCTATCATTGGAATCATCTCCTGGAGTTACTGATTTAAATGGCAATATAAAACATGAACCTTCGCAAGATGTTCTGCCAACTAAGGTAGCTAGGAGCAGCCAAGAATCAAAAAACGGTGACAGCAAAAATTTAGATCCTGAAAGTAAAGACCCTTCGAGTTTTGAGGATGATGATGCTTTCTCCTTCCAGGCTGGGAGACAGAATGTTGCCTTTCTAGAGGAGGCAAAACCTTTAGTTGCCGAGGGAGCTAATGGACTGAGTAGATTCAGTGATACACCTGGAGATGCCTCCTTGGAGGATTTATTCCCAATTGACAAGCGAGGAGATAATGGGGCTGAAGCTTCAACATCTACTACCGCTCAAGAGCTCAGGGATAGGATGGTGTCACAGAAGCAGAAGGGAAATGACAATGTGCCCATGAATGGCGGGAAACTTCTTGAATTATTTGATGAATTTCATGACAACATTCCAGGAGAGAATCTTTTCCCTTTACAGTCTGTGGAATACAGCAAAATAGTAGCACAGCTGAAGCCCGGCGAAAGTGAAGAAGTAATATTGTCAGCATGCCAAAAGCTTATGTTATTCTTCAGTCACCGGCCTGAGCAAAAACAGATTTATGTGTCACAGAATGGTTTCCTTCCGTTGATGGAACTTCTTGAACTTCCAAAAAACCGTATTATATGTTCTGTTCTGCAACTCATCAACTACATTGTAAAAGATAATACGGCCTTCCTGGAAAATGCCTGTCTTGTTGGCCTAATACCAGTGGTGATGAATTTTGCCGTGCCAGATCGTGCAAAGGAAGTCCGGATGCAAGCATCTTTTTTTCTGCAGCAGCTTTGCCAGGCCAGCACCTTGACGTTGCAAATGTTCATTGCATGCCAAGGTATACCTGTTTTGGTGAGTTTTTTGGAGCCTGACTATGCAAAATTTAGGGAAATGGTTCATCTTGCAATTGATGGCATCTGGCAGGTCTTCAAGCTTCAGCATTCAACGCCGAGAAATGACTTCTGTCGTATAGCAGCAAAGAATGGGATACTTCTCAGGCTAGTTAACACTCTTCATAGCTTGAATGAAGCAACACGATTTGCTTCCATCTCAGGGTCAGGTGCTTCAGTAACACAGAATGGTTCCACCCCCCGTCTAAAATCTGGTCAGCTAGATGTGCCGATGCTAGAAAGTTCTAAAGTAAGGCTGGATCATTACCATTCATCTGGCTCCATGCAGTCGTTACAAGCAGATGCTGATAAGCACCATATCTTATTGGATCCTTCAGCATCTCCCAGGTTCAATGATATATCTGCCGCTGGTCACATGGAGAGAAATGATAATGACCTGGTAAGGCCACAGCGGCTTAGTGTTTCTGGAGGAAGGTCATCAACAGACAGATCTCCCAAGCATATAGAATTAGTATCAAATGGACATAGTAGTGGTCAGAATGATCAAATCCGGCCTCTACTGAGTTTATTGGAGAAAGAACCTCCCTCTCGTCATGTATCTGGACAACTTGATTATGCCCGTCACATGTCTGGACTAGAAAGGCATGAGAGTATTTTGCCACTGTTACATGCTTCAGTAGAGAGGAAAACAAACGGTGAACTTGACTTGCTAATGGCAGGATTTGCTGAGGTCTCTAGACAGGGAAGAGAGAATGGTAACCTTGATTCTAATATGAAAGCTTCAAATAGGGCTCCAAGTATGAAGTATGGTCCAACAGCTTCCAATGAGGGAACATCAACATCCGGAGCAGCATCACAAACAGCATCTGGCGTGTTATCTGGATCAGGAGTGCTCAATGCAAGAATGCCAGGAAGTACAACATCATCTGGTCTATTAGCTCAAATGGTTTCTATGAGTGCTGATGTTGCACGCGAGTATCTTGAGAAAGTGGCAGATCTTCTTTTGGAGTTTGCACAAGCAGACACTGTTGTAAAATCTCTCATGTCTAGCCAAAGCCTTCTCGCACGGCTTTTCCAGATGTTCAATAAGATAGAATCTCCTATTCTTCTGAAGATTCTTAGGTGCATTAATCATTTGTCTGGTGATCCTAATTGTCTAGAGACACTTCAACGCACAGATGCTATCAAGCATTTGATACCAATTCTCGAACTTCGTGATGGACCTCTAGTTTTTCAAATACATAGCGAGGTCCTCAATGCGCTGTTCAACCTTTGTAAGATCAATAAAAGAAGACAGGAACAAGCAGCTGAAAATGGGATCATCCCTCACTTGATGAATTTTGTCATGTCAGACTCGCCGCTAAGGCAGTATGCATTGCCTCTGCTTTGTGATATGGCTCATGCTTCTCGCAACTCTAGGGAGCAGTTGAGAGCTCATGGAGGCCTGGATGTGTACTTGGACCTGTTAGAGGATGATGCATGGGCATGTACAGCTTTGGATTCCATTGCTGTTTGTTTGGCTCATGACAATGATCACAGAAAAGTAGAGCAAGCCTTGTTGAAGAAAGAGGCCATTCAGAAGTTGGTGAAATTTTTCGAAGACTGCCCTGAACAATATTTTGTTCATATACTTGATGCTTTCCTCAAAATAATCACGAAATCATCTCGGATAAATACTGCAATAGCCACCAATGGTTTGACGACATTGCTTATTGCAAGACTTGACCATCGAGAAGCTATTGCTCGTTTGACTCTGCTGAAACTAATAAAGGTTGTCTATGAGCACCACCCTCGACCAAAGCAGCTTATAGTGGAGAACGACCTTCCCCAAAAGCTACAAAACCTCATCGAAGAGCGCAGGGATGGGCAACGCGGCGGTCAACAAGTGCTGGTCAAACAAATGGCCACCTCACTGTTGAAGGCATTGCACATCAATACAGTCTTGTGATCTCCGGCCTAGGCCATCATGTGTTTTCCTCCCAAGCTGTACATGTCTGCCCTAGAGGAAAAGTTTTCGTTCTTTCTTCTTCTTTTCCCCTTGTTCCCAGCTGTGATTTCCCTTGTCATGGGCACCAGACTGGCTGTTGCGCCTGCTCCCCCTTTTATCGGGAGAAAGGTTCGACGCTCCGGTGCAAGATAACGGGGTTTGTAAATCCCTGCGATTGTTGCGCCTTCATCGATATCAGAGATACACGAGGCCCCGTCCaaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.10505 translated coding region predicted by ESTScan from UniGene Ta.10505

MASRQHNPKSKTLGNKYMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIPQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTNSHLHIILEYVENGSLANIIKPNKFGPFPESLAAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCSPPYYELQPMPALFRIVQDVQPPIPEGFSPEITDFLRQCFQKDSIQRPDAKTLLMHPWLQNSRRASSSPRQTNPRHIDMDDEVPSSDNHAGFSGPSGDTQAPVASDVEQEDGTKELVSVSAGQGKPDELHDGKPAESNISNNVELMKDNVVLTKDPTLVFHEKLSLESSPGVTDLNGNIKHEPSQDVLPTKVARSSQESKNGDSKNLDPESKDPSSFEDDDAFSFQAGRQNVAFLEEAKPLVAEGANGLSRFSDTPGDASLEDLFPIDKRGDNGAEASTSTTAQELRDRMVSQKQKGNDNVPMNGGKLLELFDEFHDNIPGENLFPLQSVEYSKIVAQLKPGESEEVILSACQKLMLFFSHRPEQKQIYVSQNGFLPLMELLELPKNRIICSVLQLINYIVKDNTAFLENACLVGLIPVVMNFAVPDRAKEVRMQASFFLQQLCQASTLTLQMFIACQGIPVLVSFLEPDYAKFREMVHLAIDGIWQVFKLQHSTPRNDFCRIAAKNGILLRLVNTLHSLNEATRFASISGSGASVTQNGSTPRLKSGQLDVPMLESSKVRLDHYHSSGSMQSLQADADKHHILLDPSASPRFNDISAAGHMERNDNDLVRPQRLSVSGGRSSTDRSPKHIELVSNGHSSGQNDQIRPLLSLLEKEPPSRHVSGQLDYARHMSGLERHESILPLLHASVERKTNGELDLLMAGFAEVSRQGRENGNLDSNMKASNRAPSMKYGPTASNEGTSTSGAASQTASGVLSGSGVLNARMPGSTTSSGLLAQMVSMSADVAREYLEKVADLLLEFAQADTVVKSLMSSQSLLARLFQMFNKIESPILLKILRCINHLSGDPNCLETLQRTDAIKHLIPILELRDGPLVFQIHSEVLNALFNLCKINKRRQEQAAENGIIPHLMNFVMSDSPLRQYALPLLCDMAHASRNSREQLRAHGGLDVYLDLLEDDAWACTALDSIAVCLAHDNDHRKVEQALLKKEAIQKLVKFFEDCPEQYFVHILDAFLKIITKSSRINTAIATNGLTTLLIARLDHREAIARLTLLKLIKVVYEHHPRPKQLIVENDLPQKLQNLIEERRDGQRGGQQVLVKQMATSLLKALHINTVL

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
3-302 Protein kinase-like (PK-like)
Protein kinase-like domain

SRQHNPKSKTLGNKYMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIPQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTNSHLHIILEYVENGSLANIIKPNKFGPFPESLAAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCSPPYYELQPMPALFRIVQDVQPPIPEGFSPEITDFLRQCFQKDSIQRPDAKTLLMHPWLQNSRRASSSPRQTNPRHIDMDDEVPSSDNHA

Gene3D: G3DSA:3.30.200.20
7-126 no description

NPKSKTLGNKYMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIPQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTNSHLHIILEYVENGSLANIIKPNKFGPFPESLAAVYIAQVL

HMMPanther: PTHR24361:SF61
14-1321 SUBFAMILY NOT NAMED,NIK-RELATED PROTEIN KINASE

GNKYMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIPQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTNSHLHIILEYVENGSLANIIKPNKFGPFPESLAAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCSPPYYELQPMPALFRIVQDVQPPIPEGFSPEITDFLRQCFQKDSIQRPDAKTLLMHPWLQNSRRASSSPRQTNPRHIDMDDEVPSSDNHAGFSGPSGDTQAPVASDVEQEDGTKELVSVSAGQGKPDELHDGKPAESNISNNVELMKDNVVLTKDPTLVFHEKLSLESSPGVTDLNGNIKHEPSQDVLPTKVARSSQESKNGDSKNLDPESKDPSSFEDDDAFSFQAGRQNVAFLEEAKPLVAEGANGLSRFSDTPGDASLEDLFPIDKRGDNGAEASTSTTAQELRDRMVSQKQKGNDNVPMNGGKLLELFDEFHDNIPGENLFPLQSVEYSKIVAQLKPGESEEVILSACQKLMLFFSHRPEQKQIYVSQNGFLPLMELLELPKNRIICSVLQLINYIVKDNTAFLENACLVGLIPVVMNFAVPDRAKEVRMQASFFLQQLCQASTLTLQMFIACQGIPVLVSFLEPDYAKFREMVHLAIDGIWQVFKLQHSTPRNDFCRIAAKNGILLRLVNTLHSLNEATRFASISGSGASVTQNGSTPRLKSGQLDVPMLESSKVRLDHYHSSGSMQSLQADADKHHILLDPSASPRFNDISAAGHMERNDNDLVRPQRLSVSGGRSSTDRSPKHIELVSNGHSSGQNDQIRPLLSLLEKEPPSRHVSGQLDYARHMSGLERHESILPLLHASVERKTNGELDLLMAGFAEVSRQGRENGNLDSNMKASNRAPSMKYGPTASNEGTSTSGAASQTASGVLSGSGVLNARMPGSTTSSGLLAQMVSMSADVAREYLEKVADLLLEFAQADTVVKSLMSSQSLLARLFQMFNKIESPILLKILRCINHLSGDPNCLETLQRTDAIKHLIPILELRDGPLVFQIHSEVLNALFNLCKINKRRQEQAAENGIIPHLMNFVMSDSPLRQYALPLLCDMAHASRNSREQLRAHGGLDVYLDLLEDDAWACTALDSIAVCLAHDNDHRKVEQALLKKEAIQKLVKFFEDCPEQYFVHILDAFLKIITKSSRINTAIATNGLTTLLIARLDHREAIARLTLLKLIKVVYEHHPRPKQLIVENDLPQKLQNLIEERRDGQRGGQQVLVKQMATSLLKALHINT

HMMPanther: PTHR24361
14-1321 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

GNKYMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIPQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTNSHLHIILEYVENGSLANIIKPNKFGPFPESLAAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCSPPYYELQPMPALFRIVQDVQPPIPEGFSPEITDFLRQCFQKDSIQRPDAKTLLMHPWLQNSRRASSSPRQTNPRHIDMDDEVPSSDNHAGFSGPSGDTQAPVASDVEQEDGTKELVSVSAGQGKPDELHDGKPAESNISNNVELMKDNVVLTKDPTLVFHEKLSLESSPGVTDLNGNIKHEPSQDVLPTKVARSSQESKNGDSKNLDPESKDPSSFEDDDAFSFQAGRQNVAFLEEAKPLVAEGANGLSRFSDTPGDASLEDLFPIDKRGDNGAEASTSTTAQELRDRMVSQKQKGNDNVPMNGGKLLELFDEFHDNIPGENLFPLQSVEYSKIVAQLKPGESEEVILSACQKLMLFFSHRPEQKQIYVSQNGFLPLMELLELPKNRIICSVLQLINYIVKDNTAFLENACLVGLIPVVMNFAVPDRAKEVRMQASFFLQQLCQASTLTLQMFIACQGIPVLVSFLEPDYAKFREMVHLAIDGIWQVFKLQHSTPRNDFCRIAAKNGILLRLVNTLHSLNEATRFASISGSGASVTQNGSTPRLKSGQLDVPMLESSKVRLDHYHSSGSMQSLQADADKHHILLDPSASPRFNDISAAGHMERNDNDLVRPQRLSVSGGRSSTDRSPKHIELVSNGHSSGQNDQIRPLLSLLEKEPPSRHVSGQLDYARHMSGLERHESILPLLHASVERKTNGELDLLMAGFAEVSRQGRENGNLDSNMKASNRAPSMKYGPTASNEGTSTSGAASQTASGVLSGSGVLNARMPGSTTSSGLLAQMVSMSADVAREYLEKVADLLLEFAQADTVVKSLMSSQSLLARLFQMFNKIESPILLKILRCINHLSGDPNCLETLQRTDAIKHLIPILELRDGPLVFQIHSEVLNALFNLCKINKRRQEQAAENGIIPHLMNFVMSDSPLRQYALPLLCDMAHASRNSREQLRAHGGLDVYLDLLEDDAWACTALDSIAVCLAHDNDHRKVEQALLKKEAIQKLVKFFEDCPEQYFVHILDAFLKIITKSSRINTAIATNGLTTLLIARLDHREAIARLTLLKLIKVVYEHHPRPKQLIVENDLPQKLQNLIEERRDGQRGGQQVLVKQMATSLLKALHINT

ProfileScan: PS50011
IPR000719
17-271 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIPQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTNSHLHIILEYVENGSLANIIKPNKFGPFPESLAAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCSPPYYELQPMPALFRIVQDVQPPIPEGFSPEITDFLRQCFQKDSIQRPDAKTLLMHPWL

HMMSmart: SM00219
IPR020635
17-271 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIPQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTNSHLHIILEYVENGSLANIIKPNKFGPFPESLAAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCSPPYYELQPMPALFRIVQDVQPPIPEGFSPEITDFLRQCFQKDSIQRPDAKTLLMHPWL

HMMSmart: SM00220
IPR002290
17-271 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YMLGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIPQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTNSHLHIILEYVENGSLANIIKPNKFGPFPESLAAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCSPPYYELQPMPALFRIVQDVQPPIPEGFSPEITDFLRQCFQKDSIQRPDAKTLLMHPWL

HMMPfam: PF00069
IPR017442
19-271 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LGDEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIPQEDLNIIMQEIDLLKNLNHKNIVKYLGSLKTNSHLHIILEYVENGSLANIIKPNKFGPFPESLAAVYIAQVLEGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCSPPYYELQPMPALFRIVQDVQPPIPEGFSPEITDFLRQCFQKDSIQRPDAKTLLMHPWL

PatternScan: PS00107
IPR017441
23-46 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGAYGRVYKGLDLENGDFVAIK

FPrintScan: PR00109
IPR001245
93-106 TYRKINASE
Serine-threonine/tyrosine-protein kinase

LEYVENGSLANIIK

Gene3D: G3DSA:1.10.510.10
127-278 no description

EGLVYLHEQGVIHRDIKGANILTTKEGLVKLADFGVATKLTEADVNTHSVVGTPYWMAPEVIEMSGVCAASDIWSVGCTVIELLTCSPPYYELQPMPALFRIVQDVQPPIPEGFSPEITDFLRQCFQKDSIQRPDAKTLLMHPWLQNSRRAS

FPrintScan: PR00109
IPR001245
131-149 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YLHEQGVIHRDIKGANILT

PatternScan: PS00108
IPR008271
137-149 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKGANILT

FPrintScan: PR00109
IPR001245
197-219 TYRKINASE
Serine-threonine/tyrosine-protein kinase

SDIWSVGCTVIELLTCSPPYYEL

FPrintScan: PR00109
IPR001245
240-262 TYRKINASE
Serine-threonine/tyrosine-protein kinase

FSPEITDFLRQCFQKDSIQRPDA

superfamily: SSF48371
IPR016024
544-742 ARM repeat,NBS
Armadillo-type fold

YSKIVAQLKPGESEEVILSACQKLMLFFSHRPEQKQIYVSQNGFLPLMELLELPKNRIICSVLQLINYIVKDNTAFLENACLVGLIPVVMNFAVPDRAKEVRMQASFFLQQLCQASTLTLQMFIACQGIPVLVSFLEPDYAKFREMVHLAIDGIWQVFKLQHSTPRNDFCRIAAKNGILLRLVNTLHSLNEATRFASIS

HMMSmart: SM00185
IPR000225
574-614 Armadillo/beta-catenin-like repeats
Armadillo

RPEQKQIYVSQNGFLPLMELLELPKNRIICSVLQLINYIVK

HMMSmart: SM00185
IPR000225
659-702 Armadillo/beta-catenin-like repeats
Armadillo

STLTLQMFIACQGIPVLVSFLEPDYAKFREMVHLAIDGIWQVFK

Seg: seg
860-871 seg

PLLSLLEKEPPS

Seg: seg
952-965 seg

GTSTSGAASQTASG

superfamily: SSF48371
IPR016024
986-1296 ARM repeat,NBS
Armadillo-type fold

LLAQMVSMSADVAREYLEKVADLLLEFAQADTVVKSLMSSQSLLARLFQMFNKIESPILLKILRCINHLSGDPNCLETLQRTDAIKHLIPILELRDGPLVFQIHSEVLNALFNLCKINKRRQEQAAENGIIPHLMNFVMSDSPLRQYALPLLCDMAHASRNSREQLRAHGGLDVYLDLLEDDAWACTALDSIAVCLAHDNDHRKVEQALLKKEAIQKLVKFFEDCPEQYFVHILDAFLKIITKSSRINTAIATNGLTTLLIARLDHREAIARLTLLKLIKVVYEHHPRPKQLIVENDLPQKLQNLIEERRD

Gene3D: G3DSA:1.25.10.10
IPR011989
998-1213 no description
Armadillo-like helical

AREYLEKVADLLLEFAQADTVVKSLMSSQSLLARLFQMFNKIESPILLKILRCINHLSGDPNCLETLQRTDAIKHLIPILELRDGPLVFQIHSEVLNALFNLCKINKRRQEQAAENGIIPHLMNFVMSDSPLRQYALPLLCDMAHASRNSREQLRAHGGLDVYLDLLEDDAWACTALDSIAVCLAHDNDHRKVEQALLKKEAIQKLVKFFEDCPEQ

HMMSmart: SM00185
IPR000225
1057-1101 Armadillo/beta-catenin-like repeats
Armadillo

DPNCLETLQRTDAIKHLIPILELRDGPLVFQIHSEVLNALFNLCK

HMMSmart: SM00185
IPR000225
1103-1142 Armadillo/beta-catenin-like repeats
Armadillo

NKRRQEQAAENGIIPHLMNFVMSDSPLRQYALPLLCDMAH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox