PRGDB00077604 (Ta.24551)

From PRG Wiki
Jump to: navigation, search
Ta.24551
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 209974223 (EU127477)
Gene Class N
Domain Type NBS
Gene Species Triticum aestivum

Comment?

Triticum aestivum CER5-like protein mRNA, complete cds

DNA Sequence

ACGCGGGCATATGCTTGCATCCATCTCGGAGTTGAAGAGAGGGAGAAAACGACTAGGTGGTGGTGGAGAGGAGATGGCGGAGGGAAACGGGACGGCGTGGGCGGGGGCGCTGTCGCCGGCGGCGCGTTATGCGGAGACGGGAGGGGCGAGCTTGACATGGGAGAACCTGACGGCCGTGCTTCCTGGGTCTGGCGGCCGGCCGACCAAGAAGCTCTTGCAAGGGTTGTACGGCTACGCCGTGCCCGGCAGGATCGTTGCCATCATGGGGCCCTCCGGCTCTGGCAAGTCCACCCTCCTCGACTCCCTCTCCGGGAGGCTGGCGAGGAATGTGCTCCAGACCGGCAAGGTGCTGCTCAACGGCAAGAAGAGGCGGCTCGACTTTGGCGCGGTGGCCTACGTGACACAGGAGAACGTTCTGCTGGGCACGCTGACCGTCCGGGAGACGGTTACCTACTCGGCGCAGCTGCGGCTGCCATCGAGCATGTCAAAGGCTGAGGTGCGCCGAGTGGTCGACGACACGCTGGACGAGATGGGCCTCCGGGAGTGCGCTGACCGGCCCATCGGCACATGGCACCTACGGGGCATTAGCGGTGGCGAGAAGAAGCGGCTGTGCATCGCACTGGAGATCCTCACACGGCCGCGCCTCCTCTTCCTCGACGAGCCCACCAGCGGCCTCGACAGCGCCTCTGCCTTCTCCGTCATCGAGACGCTTCGCACGCTTGCGATCGACGGTGGACGCACCATTGTCTCGTCGGTGCACCAGCCCAGCAGCGAGGTGTTCGCACTCTTCGACGATCTCTGCCTCCTCTCCAGCGGCGAGAGCGTCTACTTCGGAGACGCCAAACTTGCACCACAGTTCTTTGCAGAAACCGGATTCCCCTGCCCGAGCCGGAGGAACCCATCCGACCACTTCCTCCGGTGCGTCAATTCCGACTTCGACGATGTCGCCACCGCCATGAAAGGGTCCATGAAGCTCCGAGCAGAGGCAGATCTTGATCCCCTGTTGAAGTACCCGACTACGGAGATCAGAGAGCGGCTCGTGGATAAGTACCGGATCTCAGACTACGCCATGATGGTTAGGAACACAATACACGAGATAAGCAAAATAGAGGGTGTGATGGAGGAGGCAGTGAAGGGCAGCCAAGCGACCTGGTGCAAGCAGCTGCGCACGCTGACCAAGCGCTCCTACATCAACATGTACCGAGACTTCGGCTACTACAGGCTGCGCATCATCATCTACGTCCTGATGGCCATCTGCCTCGGTACCATCTACTACGACGTCGGCAACGGCTACACTGCAATCCAGGCGCGTGCCTCGTGCGGCGGCTTCGTTTCCGGCTTCATGACGTTCATGTCCATCGGCGGCTTCCCCTCCTTCATCGAGGAGATGAAGGTCTTCTCCCTCGAGCGGCAGAACGGCCACTACGGCGTCGCCGCCTACATCATATCCAACTTCCTCTCCTCCATGCCGTTCCTGTTGACCATGTCCTGGGCCAGCGCCTCCATCACATACTGGATGGTCAAGTTCCGGCCAGGATTCAGCTACTTCGCCTTCTTCGCCCTCAACCTCTATGGTGGCGTCTCCGTCATCGAGAGCCTCATGATGATCATCTCCGCCCTTGTGCCCAACTTCCTCATGGGGCTCATCCTTGGCGCCGGCGTCATTGGGATCATGATGTTGACGTCTGGATTCTTCCGGCTCCTTCCAGAACTTCCCAAGATATTCTGGAAATACCCAGTGTCCTACATTGTCTACGGCTCTTGGGGTTTGAAGGGTGCATACAAGAACGACCTGCTCGGGCTGGAGTTCGAGCCGATGACGCCGGGAGGCGAGAAGCTGACCGGCGAGTTCATCATCACCAACATGATGGGGCTGAGCGTCAGCTACTCCAAGTGGCTAGACCTAGCCATGATCTTCATCCTCCTCCTCGCCTACCGCATCACCTTCTTCTTTGTCCTCAAGGTCAAGGAGGCCGCCGCGCCCTACCTCCGCGTCGCCTACACGCGGTTCACCGTGAAGCGCCTTGAGCGGCGGGCGTCCTTCAGGGAGTCGCTGGCCATGACGTCCTTGTCCAAGCGGCACAACGCGCCGCACCCCATGGCCATGCAGGAGGGGCTCAACTCCCCCATGCAGCAGTACTGACTGGTCAATGTCGATGAGTACCAGGAGCAGCCGCCCCGGCAGTTGAGTTGATCATTACTACAACAAGAAGATAGCCGTCCGTGACATGCGTCTGTCACGATTACTTGTGTATGCGTTTCCACTTGTTAGTTTTGCTTGCAGGCTTGCGGCTTCGCTGGAAGCTTCAAGGTTCATAAACATACGGATGCATTCTTTAAAAGTTTGGTTTTACTGTAAGAAGTCGCTGCAACCAATACAGATGCGAGATAATATTACACCTCATTGTTTTGAATaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ta.24551 translated coding region predicted by ESTScan from UniGene Ta.24551

XRGHMLASISELKRGRKRLGGGGEEMAEGNGTAWAGALSPAARYAETGGASLTWENLTAVLPGSGGRPTKKLLQGLYGYAVPGRIVAIMGPSGSGKSTLLDSLSGRLARNVLQTGKVLLNGKKRRLDFGAVAYVTQENVLLGTLTVRETVTYSAQLRLPSSMSKAEVRRVVDDTLDEMGLRECADRPIGTWHLRGISGGEKKRLCIALEILTRPRLLFLDEPTSGLDSASAFSVIETLRTLAIDGGRTIVSSVHQPSSEVFALFDDLCLLSSGESVYFGDAKLAPQFFAETGFPCPSRRNPSDHFLRCVNSDFDDVATAMKGSMKLRAEADLDPLLKYPTTEIRERLVDKYRISDYAMMVRNTIHEISKIEGVMEEAVKGSQATWCKQLRTLTKRSYINMYRDFGYYRLRIIIYVLMAICLGTIYYDVGNGYTAIQARASCGGFVSGFMTFMSIGGFPSFIEEMKVFSLERQNGHYGVAAYIISNFLSSMPFLLTMSWASASITYWMVKFRPGFSYFAFFALNLYGGVSVIESLMMIISALVPNFLMGLILGAGVIGIMMLTSGFFRLLPELPKIFWKYPVSYIVYGSWGLKGAYKNDLLGLEFEPMTPGGEKLTGEFIITNMMGLSVSYSKWLDLAMIFILLLAYRITFFFVLKVKEAAAPYLRVAYTRFTVKRLERRASFRESLAMTSLSKRHNAPHPMAMQEGLNSPMQQYXLVNVDEYQEQPPRQLS

Domains

Domain Start-End Description Sequence

Seg: seg
11-31 seg

ELKRGRKRLGGGGEEMAEGNG

HMMPanther: PTHR19241:SF20
39-670 ATP-BINDING CASSETTE TRANSPORTER PLANT,ATP-BINDING CASSETTE TRANSPORTER PLANT

SPAARYAETGGASLTWENLTAVLPGSGGRPTKKLLQGLYGYAVPGRIVAIMGPSGSGKSTLLDSLSGRLARNVLQTGKVLLNGKKRRLDFGAVAYVTQENVLLGTLTVRETVTYSAQLRLPSSMSKAEVRRVVDDTLDEMGLRECADRPIGTWHLRGISGGEKKRLCIALEILTRPRLLFLDEPTSGLDSASAFSVIETLRTLAIDGGRTIVSSVHQPSSEVFALFDDLCLLSSGESVYFGDAKLAPQFFAETGFPCPSRRNPSDHFLRCVNSDFDDVATAMKGSMKLRAEADLDPLLKYPTTEIRERLVDKYRISDYAMMVRNTIHEISKIEGVMEEAVKGSQATWCKQLRTLTKRSYINMYRDFGYYRLRIIIYVLMAICLGTIYYDVGNGYTAIQARASCGGFVSGFMTFMSIGGFPSFIEEMKVFSLERQNGHYGVAAYIISNFLSSMPFLLTMSWASASITYWMVKFRPGFSYFAFFALNLYGGVSVIESLMMIISALVPNFLMGLILGAGVIGIMMLTSGFFRLLPELPKIFWKYPVSYIVYGSWGLKGAYKNDLLGLEFEPMTPGGEKLTGEFIITNMMGLSVSYSKWLDLAMIFILLLAYRITFFFVLKVKEAAAPYLRVAYTR

HMMPanther: PTHR19241
39-670 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

SPAARYAETGGASLTWENLTAVLPGSGGRPTKKLLQGLYGYAVPGRIVAIMGPSGSGKSTLLDSLSGRLARNVLQTGKVLLNGKKRRLDFGAVAYVTQENVLLGTLTVRETVTYSAQLRLPSSMSKAEVRRVVDDTLDEMGLRECADRPIGTWHLRGISGGEKKRLCIALEILTRPRLLFLDEPTSGLDSASAFSVIETLRTLAIDGGRTIVSSVHQPSSEVFALFDDLCLLSSGESVYFGDAKLAPQFFAETGFPCPSRRNPSDHFLRCVNSDFDDVATAMKGSMKLRAEADLDPLLKYPTTEIRERLVDKYRISDYAMMVRNTIHEISKIEGVMEEAVKGSQATWCKQLRTLTKRSYINMYRDFGYYRLRIIIYVLMAICLGTIYYDVGNGYTAIQARASCGGFVSGFMTFMSIGGFPSFIEEMKVFSLERQNGHYGVAAYIISNFLSSMPFLLTMSWASASITYWMVKFRPGFSYFAFFALNLYGGVSVIESLMMIISALVPNFLMGLILGAGVIGIMMLTSGFFRLLPELPKIFWKYPVSYIVYGSWGLKGAYKNDLLGLEFEPMTPGGEKLTGEFIITNMMGLSVSYSKWLDLAMIFILLLAYRITFFFVLKVKEAAAPYLRVAYTR

Gene3D: G3DSA:3.40.50.300
51-281 no description

SLTWENLTAVLPGSGGRPTKKLLQGLYGYAVPGRIVAIMGPSGSGKSTLLDSLSGRLARNVLQTGKVLLNGKKRRLDFGAVAYVTQENVLLGTLTVRETVTYSAQLRLPSSMSKAEVRRVVDDTLDEMGLRECADRPIGTWHLRGISGGEKKRLCIALEILTRPRLLFLDEPTSGLDSASAFSVIETLRTLAIDGGRTIVSSVHQPSSEVFALFDDLCLLSSGESVYFGDA

superfamily: SSF52540
52-301 P-loop containing nucleoside triphosphate hydrolases

LTWENLTAVLPGSGGRPTKKLLQGLYGYAVPGRIVAIMGPSGSGKSTLLDSLSGRLARNVLQTGKVLLNGKKRRLDFGAVAYVTQENVLLGTLTVRETVTYSAQLRLPSSMSKAEVRRVVDDTLDEMGLRECADRPIGTWHLRGISGGEKKRLCIALEILTRPRLLFLDEPTSGLDSASAFSVIETLRTLAIDGGRTIVSSVHQPSSEVFALFDDLCLLSSGESVYFGDAKLAPQFFAETGFPCPSRRNP

ProfileScan: PS50893
IPR003439
52-297 ABC_TRANSPORTER_2
ABC transporter-like

LTWENLTAVLPGSGGRPTKKLLQGLYGYAVPGRIVAIMGPSGSGKSTLLDSLSGRLARNVLQTGKVLLNGKKRRLDFGAVAYVTQENVLLGTLTVRETVTYSAQLRLPSSMSKAEVRRVVDDTLDEMGLRECADRPIGTWHLRGISGGEKKRLCIALEILTRPRLLFLDEPTSGLDSASAFSVIETLRTLAIDGGRTIVSSVHQPSSEVFALFDDLCLLSSGESVYFGDAKLAPQFFAETGFPCPS

HMMSmart: SM00382
IPR003593
82-274 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGRIVAIMGPSGSGKSTLLDSLSGRLARNVLQTGKVLLNGKKRRLDFGAVAYVTQENVLLGTLTVRETVTYSAQLRLPSSMSKAEVRRVVDDTLDEMGLRECADRPIGTWHLRGISGGEKKRLCIALEILTRPRLLFLDEPTSGLDSASAFSVIETLRTLAIDGGRTIVSSVHQPSSEVFALFDDLCLLSSGE

HMMPfam: PF00005
IPR003439
97-224 ABC_tran
ABC transporter-like

STLLDSLSGRLARNVLQTGKVLLNGKKRRLDFGAVAYVTQENVLLGTLTVRETVTYSAQLRLPSSMSKAEVRRVVDDTLDEMGLRECADRPIGTWHLRGISGGEKKRLCIALEILTRPRLLFLDEPTS

PatternScan: PS00211
IPR017871
196-210 ABC_TRANSPORTER_1
ABC transporter, conserved site

ISGGEKKRLCIALEI

HMMPfam: PF01061
IPR013525
388-595 ABC2_membrane
ABC-2 type transporter

QLRTLTKRSYINMYRDFGYYRLRIIIYVLMAICLGTIYYDVGNGYTAIQARASCGGFVSGFMTFMSIGGFPSFIEEMKVFSLERQNGHYGVAAYIISNFLSSMPFLLTMSWASASITYWMVKFRPGFSYFAFFALNLYGGVSVIESLMMIISALVPNFLMGLILGAGVIGIMMLTSGFFRLLPELPKIFWKYPVSYIVYGSWGLKGAY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox