PRGDB00077606 (Ta.24799)

From PRG Wiki
Jump to: navigation, search
Ta.24799
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 29892700 (AY249528)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum NBS-LRR type R protein (FcDR2) mRNA, partial cds

DNA Sequence

GGAATggggggggtggggAAAACAACACTTGCTGCTGCAGTTTATAATTCCATCGCTGACCATTTTGAAGCTTTGTGTTTCCTTGAAAACGTGAGAGAAACTTCAAAAAAACATGGGATACAACATCTCCAAAGCAACCTTCTTTCTGAAACAGTTGGAGAGCATAAGTTAATAGGTGTGAAACAAGGAATTTCCATAATACAGCATAGGCTTCAGCAACAGAAGATTCTTTTGATTCTAGATGATGTTGACAAAAGGGAGCAGCTACAGGCGCTTGCTGGAAGACCTGATTTGTTTGGTCTTGGCAGTAGAGTCATCATCACGACTCGGGACAAACAATTGCTAGCATGTCACGGTGTTGAACGAACATATGAGGTGAATGAATTGAACGAGGAACATGCTCTTGAATTACTTAGTTGGAAAGCTTTCAAGTTGGAAAAAGTTGATCCATTTTACAAGGATGTTCTGAATCGAGCAGCAACTTATGCTTCGGGCCTGCCTCTCGCCTT


Protein sequences

Name Description Sequence
Ta.24799 translated coding region predicted by ESTScan from UniGene Ta.24799

GMGGVGKTTLAAAVYNSIADHFEALCFLENVRETSKKHGIQHLQSNLLSETVGEHKLIGVKQGISIIQHRLQQQKILLILDDVDKREQLQALAGRPDLFGLGSRVIITTRDKQLLACHGVERTYEVNELNEEHALELLSWKAFKLEKVDPFYKDVLNRAATYASGLPLAX

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-164 P-loop containing nucleoside triphosphate hydrolases

GMGGVGKTTLAAAVYNSIADHFEALCFLENVRETSKKHGIQHLQSNLLSETVGEHKLIGVKQGISIIQHRLQQQKILLILDDVDKREQLQALAGRPDLFGLGSRVIITTRDKQLLACHGVERTYEVNELNEEHALELLSWKAFKLEKVDPFYKDVLNRAATYAS

HMMPanther: PTHR11017:SF20
1-169 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GMGGVGKTTLAAAVYNSIADHFEALCFLENVRETSKKHGIQHLQSNLLSETVGEHKLIGVKQGISIIQHRLQQQKILLILDDVDKREQLQALAGRPDLFGLGSRVIITTRDKQLLACHGVERTYEVNELNEEHALELLSWKAFKLEKVDPFYKDVLNRAATYASGLPLA

HMMPanther: PTHR11017
1-169 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GMGGVGKTTLAAAVYNSIADHFEALCFLENVRETSKKHGIQHLQSNLLSETVGEHKLIGVKQGISIIQHRLQQQKILLILDDVDKREQLQALAGRPDLFGLGSRVIITTRDKQLLACHGVERTYEVNELNEEHALELLSWKAFKLEKVDPFYKDVLNRAATYASGLPLA

HMMPfam: PF00931
IPR002182
1-169 NB-ARC,NBS
NB-ARC

GMGGVGKTTLAAAVYNSIADHFEALCFLENVRETSKKHGIQHLQSNLLSETVGEHKLIGVKQGISIIQHRLQQQKILLILDDVDKREQLQALAGRPDLFGLGSRVIITTRDKQLLACHGVERTYEVNELNEEHALELLSWKAFKLEKVDPFYKDVLNRAATYASGLPLA

Gene3D: G3DSA:3.40.50.300
1-140 no description

GMGGVGKTTLAAAVYNSIADHFEALCFLENVRETSKKHGIQHLQSNLLSETVGEHKLIGVKQGISIIQHRLQQQKILLILDDVDKREQLQALAGRPDLFGLGSRVIITTRDKQLLACHGVERTYEVNELNEEHALELLSW

Seg: seg
66-80 seg

IIQHRLQQQKILLIL

FPrintScan: PR00364
IPR000767
70-84 DISEASERSIST
Disease resistance protein

RLQQQKILLILDDVD

Seg: seg
125-138 seg

EVNELNEEHALELL

FPrintScan: PR00364
IPR000767
163-170 DISEASERSIST
Disease resistance protein

ASGLPLAX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox