PRGDB00077609 (Ta.25393)

From PRG Wiki
Jump to: navigation, search
Ta.25393
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241983377 (AK331317)
Gene Class N
Domain Type NBS, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: WT007_D05, cultivar: Chinese Spring

DNA Sequence

GAACTTATCCCCTCCCGAGCGGAGCCGCCATAgccgccacctcctccgcccctctcctgtggctgcctccggcgccgtgcgcctcaccctcctccCCATCTTCTCCATCGCTACCAACCACCGCCCTCcgccacccaagtcgagccgccgccgcccaagtcgagccgccgccgccggatcagcttgccgccCACCTTCTCCCCATATGCTCCGTCCAGCCTGCCGCTTCTCTTAACCGCTGCCGGATCGAGCTCGCCTCGCAGCTGAACGGGGAGGTACCTCACGATTTCGTTGTCGTCTGATCTTAACTAATTTTGCTCTCTGATCTTAAATTGCAACAAGTCTGTGAGGATAACTACGAGGTATCTGTGATGGATGTGGGGTGGAGGAAGAGGGCGGAGGCGGTGATGGATTTGGGGAGTAGGAAGAATTGGGGGGTGTATACGGGCATATTCATTGTGCTCATGCTCGTCATACCCGCTATCCCGCATGATGAGGACTATCATGACTTTGCCGACCAACGCACACTTTTCCTTGGGATCCCTAATACGCTGAATGTGATCTCAATAATTCCCTTCATTTTTGTTGGTCTTGCCGGGCTTATCCTTAACCACTGCGAAAGCTCACAGAGGGGTCTCTACACAATCTTCTTTGCTGGTGTCAGTGTTGTTGGTTTTGGTTCATTCTTTTACCATCTCAACCCGAAAAATGACTCACTATTTTGGGACACATTGCCAATGATGGTCACTTTCACATCTTTCGAGGCCATTTTCATTATCGAAAGGTTTGATGATTTGGCAGGAACAAAGTCGTTTGCATCAACGAGCTACTGGCTATGTGCAGCAGGATTTTACGTTCTTGCAAGAGTACAAGAGGTTGCAGACAAACCAATTTATACGTGGACACTTCATATTGTCAGTGGGCATACTCTTGGTCATTTATGTGCTGCAATGGTGCCTCTTTTTTATATTCTCTTGTTAGAGAAAAGGACAAGGCCAATTCAACCAGAAAGGCACATGATTCTAGTGCATCATCAATTAAAGCTTGCTTTCATGGTCTGCTTATTGGTGCCCAAGATGATCTGCCTATGGATGCCCAAGTTACAGGTTAGTGCCATAATGTATGAAATCAGCATTTTGATGTGGGAGTTCAGTGCTCGTTATGTGGCTAATCAGGCAAAGACCTCTGAAGAGCGAGGAATGTTAGAAACCCCAATTCGTGCTCGGCAAATAGTGCCTCGTGTTCGCGGCCTTTATGGGATGGACATTTATAAGAATAAGGTCTTAGAATTCTTACAAAGTGAACGATCTGATGAGTCTATATTTGGATTATGGGGCACGTCGGGTGTTGGCAAGACACGGCTTCTTTCACTCATCGCTGATAGCTTTGCCGATTCATTTCATCACGTCATATTTCTTGATGGTGGTAGTAGCGTCAGAGTTATGCAAAATCATTTCGCATACTTTTTGAAATTGGATTGGGAGACAATCTCATTGTTGGAGGAGCATTACCGAGCTAAAATCATCATGGAGTACCTAGAGCATGTCAGTTTTTTGGTTCTGTTAGACGATGTGCAAGATGAAGTCTACCCAGATTTGACAGCTGTTGGTTTGCCGATGGCTCTTGGGCATAGGCAAAAGGTTATTCTTACGTCGAGGAGTCAGGTAGCATGTGCTCGCATGGGATGCACCATATCAAACACTCTGGAGATGAAGTGTCTCGGGGATGAAGATGCTTGGAGTCTTTTCGAGTATAATGCGGGAGTAAAAATCACAGAAGCTGATACTGAAATTTATGAATATGCAAAAAAGATGGTTTCAGCATGTGGAGGGTTGCCTAGAGCCATATGTGCTATTGGCATAGGCGTAGCCGGTGCCACTTGCAGGGGAAAACATCCAGATGATTGGTGGTTTACCTACAAGCGTTTCAAGGCTAAAAATCTGCCACCGGAACGAATGGAAGAAATAGTGCCTGTTCTGGTTTAGGCAACTTGTGCGTGGCTCCTAGGAGCTGTGGAGACATGGTTGGACTTCATTACGTGTTGCTGCCACAATGAAGTGTTGGAAGAGTCCAGATGGCGGCAGTTTGATGCTTACTTGTGAATATGGTGTGATATGTTTGATGATATTACTTTTTCTAGTATGTGTTTTCTTGACTTGTCAGTCTTCTGATGCGTAAACACAGAGAGCAGAACACCTTCATGCTCCTTAAGCACTCCGGGCAGTTGGCCTTTTAAAAATTGTATTATATaaaaaaaaaaaaaaaaaaaaaaagaaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.25393 translated coding region predicted by ESTScan from UniGene Ta.25393

XTYPLPSGAAIAATSSAPLLWLPPAPCASPSSPSSPSLPTTALRHPSRAAAAQVEPPPPDQLAAHLLPICSVQPAASLNRCRIELASQLNGEVPHDFVVVXSXLILLSDLKLQQVCEDNYEVSVMDVGWRKRAEAVMDLGSRKNWGVYTGIFIVLMLVIPAIPHDEDYHDFADQRTLFLGIPNTLNVISIIPFIFVGLAGLILNHCESSQRGLYTIFFAGVSVVGFGSFFYHLNPKNDSLFWDTLPMMVTFTSFEAIFIIERFDDLAGTKSFASTSYWLCAAGFYVLARVQEVADKPIYTWTLHIVSGHTLGHLCAAMVPLFYILLLEKRTRPIQPERHMILVHHQLKLAFMVCLLVPKMICLWMPKLQVSAIMYEISILMWEFSARYVANQAKTSEERGMLETPIRARQIVPRVRGLYGMDIYKNKVLEFLQSERSDESIFGLWGTSGVGKTRLLSLIADSFADSFHHVIFLDGGSSVRVMQNHFAYFLKLDWETISLLEEHYRAKIIMEYLEHVSFLVLLDDVQDEVYPDLTAVGLPMALGHRQKVILTSRSQVACARMGCTISNTLEMKCLGDEDAWSLFEYNAGVKITEADTEIYEYAKKMVSACGGLPRAICAIGIGVAGATCRGKHPDDWWFTYKRFKAKNLPPERMEEIVPVLVXATCAWLLGAVETWLDFITCCCHNEVLEESRWRQFDAYL

Domains

Domain Start-End Description Sequence

Seg: seg
12-43 seg

AATSSAPLLWLPPAPCASPSSPSSPSLPTTAL

Seg: seg
98-115 seg

VVVXSXLILLSDLKLQQV

superfamily: SSF52540
401-630 P-loop containing nucleoside triphosphate hydrolases

MLETPIRARQIVPRVRGLYGMDIYKNKVLEFLQSERSDESIFGLWGTSGVGKTRLLSLIADSFADSFHHVIFLDGGSSVRVMQNHFAYFLKLDWETISLLEEHYRAKIIMEYLEHVSFLVLLDDVQDEVYPDLTAVGLPMALGHRQKVILTSRSQVACARMGCTISNTLEMKCLGDEDAWSLFEYNAGVKITEADTEIYEYAKKMVSACGGLPRAICAIGIGVAGATCRG

HMMPfam: PF00931
IPR002182
425-647 NB-ARC,NBS
NB-ARC

KNKVLEFLQSERSDESIFGLWGTSGVGKTRLLSLIADSFADSFHHVIFLDGGSSVRVMQNHFAYFLKLDWETISLLEEHYRAKIIMEYLEHVSFLVLLDDVQDEVYPDLTAVGLPMALGHRQKVILTSRSQVACARMGCTISNTLEMKCLGDEDAWSLFEYNAGVKITEADTEIYEYAKKMVSACGGLPRAICAIGIGVAGATCRGKHPDDWWFTYKRFKAKN

Gene3D: G3DSA:3.40.50.300
434-528 no description

SERSDESIFGLWGTSGVGKTRLLSLIADSFADSFHHVIFLDGGSSVRVMQNHFAYFLKLDWETISLLEEHYRAKIIMEYLEHVSFLVLLDDVQDE

FPrintScan: PR00364
IPR000767
441-456 DISEASERSIST
Disease resistance protein

IFGLWGTSGVGKTRLL

FPrintScan: PR00364
IPR000767
512-526 DISEASERSIST
Disease resistance protein

YLEHVSFLVLLDDVQ

FPrintScan: PR00364
IPR000767
609-623 DISEASERSIST
Disease resistance protein

CGGLPRAICAIGIGV

Seg: seg
615-626 seg

AICAIGIGVAGA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox