PRGDB00077621 (Ta.25981)

From PRG Wiki
Jump to: navigation, search
Ta.25981
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241988091 (AK335348)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: WT012_K22, cultivar: Chinese Spring

DNA Sequence

GAGGCCGCGGGACCTCAGTCCACAGAACGGGCAAACCCTTGGCCGCGTCGCGTGCTGCTCCGGCGACTTCCGTTGCATGCTTCCGGGCAACCCAGTCAAAGTCCGTCAGTACTCCACAGTTGATGCGCTTGGCGTTACTGGGATTCTCGGCTATGGTCAAGTCTGAGGTCGTCGATGCTCCGGCCAGCCAAACAATTGATTCACGAAGGTAGTCTGCTCTGCTGGTGTCTGCCATTGATGTGGCCTGCATCTGGTTCCATGCAACAAAGGCCTCCTCGGGTCTTACCTTCAGCTACTCGGGGCAGAAAGTTTCTGTGAAGAGATTCAGATAGTGAAGATCACAAAGTAAGAGCGACAAGATGGAGTTGGTAGTAGGTGCCTCAAACACTACCATGAGGTCTCTCCTGGGCAAGCTGGGTGGCCTTCTTGCCCAGGAGTATGCTCTGATGAGTGGAGTCCGTGGCGATGTTCAGTACATCAATGATGAGCTTGCAAGCATGCAGGCCTTTCTCCGTGACCTGAGCACTGCCCCAGACCGTCATGACAACCGGCTCAAGGACTGGATGAAGCAGATCCGTGACATGGGCTATGACATTGAAGATTGCATTGATGACTTTGCCCACCGCATCCCCCGAGATCCCAGCAGTGATTTCAAATGCTTATTCATCAGGACAAGATTCTACGAACTCCGGACGTGGTGGCCTCGCCGTAACATTGCGTCCAAGATTGCTGAACTCAAGGTGCGGGCGCAACAGATTGGTAAGCGCCGTAGACGATATGGAGTGGACAACCCAATCAACTTGAACAATGGTCCTCTTGTTCGTGCTGTTACGTACGAAATTGCTGAGCATCAGCTCACAGGCCATCAGCTCATTGTTACGAAGGAACCTGTGGGGGTGACGGCTGACATGAAGAAGCTCGAGGATTGGTTGGACTTGGACAAACCTGTTGAAATGTGTGATAAGGAGCGAATTGTTCTGTCCATAGCCGGATTTGGCGGCGTGGGGAAGACCACTATTGCGATGGCGTTGTACCAAAATGCCAGGGATAAATTTGATTGTCGGGCATCGGTCACAGTATCTCAAAACTATGATCAGGGTGCAGTGCTCAGGATGATTCTGAAACAAGTCAAGCCACACGAGAGTGATCCCAATATTGAAGGAAGGAGCCACAGCGAACTCATGGAAGAACTAAAAACTTATCTGGCCGAAAAGAGATATCTCCTCCTGATTGATGACATATGGTCTGCACAAACATGGGAGAATATCAGAAAATGCTTGCCACATAATGATAAAAAAGGCAGCAGAGTAATAGTGACTACAAGATTTCAGGCTGTTGGTAGTGCTGCTTGCTCACGAAGAGCAGAAATTAATTTTCTTCATTCAGTCGATTTTCTTAGTGATGAAGAGTCTAAAAAATTGTTTGATCAAAGTGTTTCTGAATCCAACAACAACATAGGTAGTGAGAAAGAACTCCCACCTGAAGATGTATGGAAAATATGCAGGGGTCTGCCTTTGGCCATAGTTACCATGGCTGGTATTGTTGCTAGCAACCCTCGCAAATCCATCAAAGACTGGAAAGAGGCATGTAACTCATTATTTCCAGAGTTGATGCCTTCTCTGACCCTGGATGGTGTTACAAGGATACTCGATTATTGCTACAATGATTTGCCTGCAGATCTCAGGACCTGCTCTTTGTACCTGAGCATATTTCCTAAGGGTTCAAAAATTAGTAGGAAGCGTTTCACCCGGAGGTTGATAGCCGAAGGTTTCGTTAGTGAGAAGCAAGGCTTGTCAGATGAAGAAGTTGCAGAAACATACTTTAATCAGCTGATAAAAAGGAAGATAATACGTCCAGTGGAGCACAGCAGCAACGGGAAGATAAAAAGCTTTCAAGTGCATGATATGGTCCTTGAATATATTGTTTCGAAGTCAAGCGAAGAGAATTTTATTACTGTGGTTGGTGGCCACTGGCTGGTGCCAATGCCGACCAATAAAATCCGCCGACTCTCTGTACAAAGCAGTGGTTCTGAGCATGGGAATTCAACGAAACACATGAACTTATCGCAAGTGCGATCTCTGACCATGTTCCGGAGCCTAGACCAACTTCATTTCCATTCTTTCAATAATGGAATTTTACAAGTCCTGGATCTTGAGGGTTGCAAGGGTTTGAAAGAGAAACATCTGAATGACATGTGTAGAATGCTTGTACTGAAGTATTTGAGCCTTAGGCAGACAGATATTTCCAAAATACCCTCTAAGATTGCAAAACTCGAGTACCTAGAAACTCTTGACCTAAGGGAGACGAATGTTACTGAGCTCCCAAAATCTGCAGGACAGCTCAAACGGATAATTAATATATTTGGCGGGAATAAAAGCTCAAGGAAGGGTTTAAAGTTGCCTCAAGAGATAACTAAGGAGACAATGAAAGCACTCCGTGTACTGTCAGGGATCGAGATTGATGACAAATCAACAGGTGTTGCTGGCCTCCATCAATTGACGGGGCTTAGGAAGCTTGCAATTTACAAGCTCAGATCACAGAAGGGTAGTGAAACCTTGACACAGTTAGGCTCTGCTATCGAGTATCTTGGCAGCTGTGGTCTGCAGACTCTGGTGCTCAACGACGAGGGATCTGATTTTATCAACTTGTTGGACACCATGTCCGGCGCACCTCCAAGATACCTCAGTGCCCTTGAGCTCTCTGGCAATTTGAAAGATGTTCCCCAGTGGATTACCAAACTCAGTAACCTCAACAAGTTGACCCTTTCTGTGACAGTTCTCCGGACAGATACTTTTGTGCTCCTGCGCGACCTGCCTTTGTTGTTTTCCCTCACCTTTTCGCTGAGTGCAGCGAAGCAGGATGAGGCCATAGTGGACATCATTGATGATAACAAATCACAGTCTGGTGGGGTAATCTACGTTCCAGGTGAGGGATTCAAGAGTCTTAAGCTGCTTCGCTTCTTTGCACCTCTAGTGCCAAAGCTGAGCTTCCCAGAAGATGCAATGCCAGCACTTGAAAGGATCGAGATGCGGTTCGAAGCCTTTGAGGGCCTTTTCGGTGTTGACACCCTGAAAAGTCTCAAGGAGGTGCACCTCAGAGTCAATAGCACAGCAGATGACATAACCAACTTCATAGTAGATGATTTGAAGGCCATCAAGGCGCCAAAGATAATCGTGGATCATGTTATCAGCAGCTGAAATATGGCATTCTCATGGAGCGCTTACTCATCATCCATCTTTACCCTCTGTTTGTCGAGATTACTGGTTTAGTTTGTGCCATTCGTACTTCAATAAAAACAGGACACTGCTGCGTGCCTGTAAGCCACAAGACTCTTATGATTTTTGCTTGTGAAATTCGAACGTTATTTCGTTTTGGGCTTGTAAGTTAATTTGACTTTAACTTGAAACTGTGAGCGTTTGTCAAAGATATTTGTATTACCGATCATGAGAAAACTTTCCGCATGaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaagaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.25981 translated coding region predicted by ESTScan from UniGene Ta.25981

XGRGTSVHRTGKPLAASRAAPATSVACFRATQSKSVSTPQLMRLALLGFSAMVKSEVVDAPASQTIDSRRXSALLVSAIDVACIWFHATKASSGLTFSYSGQKVSVKRFRXXRSQSKSDKMELVVGASNTTMRSLLGKLGGLLAQEYALMSGVRGDVQYINDELASMQAFLRDLSTAPDRHDNRLKDWMKQIRDMGYDIEDCIDDFAHRIPRDPSSDFKCLFIRTRFYELRTWWPRRNIASKIAELKVRAQQIGKRRRRYGVDNPINLNNGPLVRAVTYEIAEHQLTGHQLIVTKEPVGVTADMKKLEDWLDLDKPVEMCDKERIVLSIAGFGGVGKTTIAMALYQNARDKFDCRASVTVSQNYDQGAVLRMILKQVKPHESDPNIEGRSHSELMEELKTYLAEKRYLLLIDDIWSAQTWENIRKCLPHNDKKGSRVIVTTRFQAVGSAACSRRAEINFLHSVDFLSDEESKKLFDQSVSESNNNIGSEKELPPEDVWKICRGLPLAIVTMAGIVASNPRKSIKDWKEACNSLFPELMPSLTLDGVTRILDYCYNDLPADLRTCSLYLSIFPKGSKISRKRFTRRLIAEGFVSEKQGLSDEEVAETYFNQLIKRKIIRPVEHSSNGKIKSFQVHDMVLEYIVSKSSEENFITVVGGHWLVPMPTNKIRRLSVQSSGSEHGNSTKHMNLSQVRSLTMFRSLDQLHFHSFNNGILQVLDLEGCKGLKEKHLNDMCRMLVLKYLSLRQTDISKIPSKIAKLEYLETLDLRETNVTELPKSAGQLKRIINIFGGNKSSRKGLKLPQEITKETMKALRVLSGIEIDDKSTGVAGLHQLTGLRKLAIYKLRSQKGSETLTQLGSAIEYLGSCGLQTLVLNDEGSDFINLLDTMSGAPPRYLSALELSGNLKDVPQWITKLSNLNKLTLSVTVLRTDTFVLLRDLPLLFSLTFSLSAAKQDEAIVDIIDDNKSQSGGVIYVPGEGFKSLKLLRFFAPLVPKLSFPEDAMPALERIEMRFEAFEGLFGVDTLKSLKEVHLRVNSTADDITNFIVDDLKAIKAPKIIVDHVISS

Domains

Domain Start-End Description Sequence

Seg: seg
15-26 seg

AASRAAPATSVA

Seg: seg
102-118 seg

QKVSVKRFRXXRSQSKS

HMMPanther: PTHR23155:SF220
128-1049 OS11G0689100 PROTEIN,OS11G0689100 PROTEIN

SNTTMRSLLGKLGGLLAQEYALMSGVRGDVQYINDELASMQAFLRDLSTAPDRHDNRLKDWMKQIRDMGYDIEDCIDDFAHRIPRDPSSDFKCLFIRTRFYELRTWWPRRNIASKIAELKVRAQQIGKRRRRYGVDNPINLNNGPLVRAVTYEIAEHQLTGHQLIVTKEPVGVTADMKKLEDWLDLDKPVEMCDKERIVLSIAGFGGVGKTTIAMALYQNARDKFDCRASVTVSQNYDQGAVLRMILKQVKPHESDPNIEGRSHSELMEELKTYLAEKRYLLLIDDIWSAQTWENIRKCLPHNDKKGSRVIVTTRFQAVGSAACSRRAEINFLHSVDFLSDEESKKLFDQSVSESNNNIGSEKELPPEDVWKICRGLPLAIVTMAGIVASNPRKSIKDWKEACNSLFPELMPSLTLDGVTRILDYCYNDLPADLRTCSLYLSIFPKGSKISRKRFTRRLIAEGFVSEKQGLSDEEVAETYFNQLIKRKIIRPVEHSSNGKIKSFQVHDMVLEYIVSKSSEENFITVVGGHWLVPMPTNKIRRLSVQSSGSEHGNSTKHMNLSQVRSLTMFRSLDQLHFHSFNNGILQVLDLEGCKGLKEKHLNDMCRMLVLKYLSLRQTDISKIPSKIAKLEYLETLDLRETNVTELPKSAGQLKRIINIFGGNKSSRKGLKLPQEITKETMKALRVLSGIEIDDKSTGVAGLHQLTGLRKLAIYKLRSQKGSETLTQLGSAIEYLGSCGLQTLVLNDEGSDFINLLDTMSGAPPRYLSALELSGNLKDVPQWITKLSNLNKLTLSVTVLRTDTFVLLRDLPLLFSLTFSLSAAKQDEAIVDIIDDNKSQSGGVIYVPGEGFKSLKLLRFFAPLVPKLSFPEDAMPALERIEMRFEAFEGLFGVDTLKSLKEVHLRVNSTADDITNFIVDDL

HMMPanther: PTHR23155
128-1049 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SNTTMRSLLGKLGGLLAQEYALMSGVRGDVQYINDELASMQAFLRDLSTAPDRHDNRLKDWMKQIRDMGYDIEDCIDDFAHRIPRDPSSDFKCLFIRTRFYELRTWWPRRNIASKIAELKVRAQQIGKRRRRYGVDNPINLNNGPLVRAVTYEIAEHQLTGHQLIVTKEPVGVTADMKKLEDWLDLDKPVEMCDKERIVLSIAGFGGVGKTTIAMALYQNARDKFDCRASVTVSQNYDQGAVLRMILKQVKPHESDPNIEGRSHSELMEELKTYLAEKRYLLLIDDIWSAQTWENIRKCLPHNDKKGSRVIVTTRFQAVGSAACSRRAEINFLHSVDFLSDEESKKLFDQSVSESNNNIGSEKELPPEDVWKICRGLPLAIVTMAGIVASNPRKSIKDWKEACNSLFPELMPSLTLDGVTRILDYCYNDLPADLRTCSLYLSIFPKGSKISRKRFTRRLIAEGFVSEKQGLSDEEVAETYFNQLIKRKIIRPVEHSSNGKIKSFQVHDMVLEYIVSKSSEENFITVVGGHWLVPMPTNKIRRLSVQSSGSEHGNSTKHMNLSQVRSLTMFRSLDQLHFHSFNNGILQVLDLEGCKGLKEKHLNDMCRMLVLKYLSLRQTDISKIPSKIAKLEYLETLDLRETNVTELPKSAGQLKRIINIFGGNKSSRKGLKLPQEITKETMKALRVLSGIEIDDKSTGVAGLHQLTGLRKLAIYKLRSQKGSETLTQLGSAIEYLGSCGLQTLVLNDEGSDFINLLDTMSGAPPRYLSALELSGNLKDVPQWITKLSNLNKLTLSVTVLRTDTFVLLRDLPLLFSLTFSLSAAKQDEAIVDIIDDNKSQSGGVIYVPGEGFKSLKLLRFFAPLVPKLSFPEDAMPALERIEMRFEAFEGLFGVDTLKSLKEVHLRVNSTADDITNFIVDDL

superfamily: SSF52540
280-541 P-loop containing nucleoside triphosphate hydrolases

EIAEHQLTGHQLIVTKEPVGVTADMKKLEDWLDLDKPVEMCDKERIVLSIAGFGGVGKTTIAMALYQNARDKFDCRASVTVSQNYDQGAVLRMILKQVKPHESDPNIEGRSHSELMEELKTYLAEKRYLLLIDDIWSAQTWENIRKCLPHNDKKGSRVIVTTRFQAVGSAACSRRAEINFLHSVDFLSDEESKKLFDQSVSESNNNIGSEKELPPEDVWKICRGLPLAIVTMAGIVASNPRKSIKDWKEACNSLFPELMPSL

HMMPfam: PF00931
IPR002182
317-596 NB-ARC,NBS
NB-ARC

VEMCDKERIVLSIAGFGGVGKTTIAMALYQNARDKFDCRASVTVSQNYDQGAVLRMILKQVKPHESDPNIEGRSHSELMEELKTYLAEKRYLLLIDDIWSAQTWENIRKCLPHNDKKGSRVIVTTRFQAVGSAACSRRAEINFLHSVDFLSDEESKKLFDQSVSESNNNIGSEKELPPEDVWKICRGLPLAIVTMAGIVASNPRKSIKDWKEACNSLFPELMPSLTLDGVTRILDYCYNDLPADLRTCSLYLSIFPKGSKISRKRFTRRLIAEGFVSEKQ

Gene3D: G3DSA:3.40.50.300
319-442 no description

MCDKERIVLSIAGFGGVGKTTIAMALYQNARDKFDCRASVTVSQNYDQGAVLRMILKQVKPHESDPNIEGRSHSELMEELKTYLAEKRYLLLIDDIWSAQTWENIRKCLPHNDKKGSRVIVTTR

FPrintScan: PR00364
IPR000767
326-341 DISEASERSIST
Disease resistance protein

VLSIAGFGGVGKTTIA

FPrintScan: PR00364
IPR000767
401-415 DISEASERSIST
Disease resistance protein

YLAEKRYLLLIDDIW

FPrintScan: PR00364
IPR000767
501-515 DISEASERSIST
Disease resistance protein

CRGLPLAIVTMAGIV

superfamily: SSF52058
632-1035 L domain-like,LRR

QVHDMVLEYIVSKSSEENFITVVGGHWLVPMPTNKIRRLSVQSSGSEHGNSTKHMNLSQVRSLTMFRSLDQLHFHSFNNGILQVLDLEGCKGLKEKHLNDMCRMLVLKYLSLRQTDISKIPSKIAKLEYLETLDLRETNVTELPKSAGQLKRIINIFGGNKSSRKGLKLPQEITKETMKALRVLSGIEIDDKSTGVAGLHQLTGLRKLAIYKLRSQKGSETLTQLGSAIEYLGSCGLQTLVLNDEGSDFINLLDTMSGAPPRYLSALELSGNLKDVPQWITKLSNLNKLTLSVTVLRTDTFVLLRDLPLLFSLTFSLSAAKQDEAIVDIIDDNKSQSGGVIYVPGEGFKSLKLLRFFAPLVPKLSFPEDAMPALERIEMRFEAFEGLFGVDTLKSLKEVHLRVN

FPrintScan: PR00364
IPR000767
756-772 DISEASERSIST
Disease resistance protein

AKLEYLETLDLRETNVT

Seg: seg
938-949 seg

LPLLFSLTFSLS

Gene3D: G3DSA:3.80.10.10
1015-1040 no description

FEGLFGVDTLKSLKEVHLRVNSTADD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox