PRGDB00077633 (Ta.26224)

From PRG Wiki
Jump to: navigation, search
Ta.26224
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 31367706 (CD452966)
Gene Class N
Domain Type NBS
Gene Species Triticum aestivum

Comment?

WHE1141_F09_K17ZT CS wheat etiolated seedling root normalized cDNA library Triticum aestivum cDNA clone WHE1141_F09_K17, mRNA sequence

DNA Sequence

ttttttttttttttttttCAATTGCAGGTATGCATCTAAGGATCTGTCGGGTGAGGTTGAGCACATCAAAATCAGTTGAGACACACACCCAAACCCTGACAGTGAACTGCTCCTCAACCCTTTTATCATTATACAAGTGTTGGGTGAAGGTTGTCTTTCCCATACCCCCAGGGCCGTCAAAAGGCAGAATATAAAGGGTTTCATCAAGATATGTGCTACCAGTGAGCGCACTTACAGTTTGCTCAAAGATGGCTCTCCTTCCGTATAATTTATCTTGTGAAACTACTGAACCTGTGGGAGGCCTTTTTAGGGTGCCAGTTGTGCTTGCTGCGGTGCTACTATGGTTTTCAATTTTGAGCAAGTTAGACACAGGTCCACATATGGAGTTCATTTCCTCCATTACTGACTTGATTTTGTTGGACATGGCTACTCTATCAAAAAACAACTTATCAACATGGCCGCCATCATGGCCACTACCAGACTTGGTTGCTTTGTCTGGGTTACTGATGACAGCAGCAGCAGAAGGAACTTCGGCTTGAGTACGCGAGCAAGAAAAGCATGGAAGCCAGTTACCGATGGTATGGCGAGCAGCATGGCGACCATGGAGAGCATGACCA


Protein sequences

Name Description Sequence
Ta.26224 translated coding region predicted by ESTScan from UniGene Ta.26224

XGHALHGRHAARHTIGNWLPCFSCSRTQAEVPSAAAVISNPDKATKSGSGHDGGHVDKLFFDRVAMSNKIKSVMEEMNSICGPVSNLLKIENHSSTAASTTGTLKRPPTGSVVSQDKLYGRRAIFEQTVSALTGSTYLDETLYILPFDGPGGMGKTTFTQHLYNDKRVEEQFTVRVW

Domains

Domain Start-End Description Sequence

Seg: seg
1-13 seg

XGHALHGRHAARH

superfamily: SSF52540
101-177 P-loop containing nucleoside triphosphate hydrolases

TGTLKRPPTGSVVSQDKLYGRRAIFEQTVSALTGSTYLDETLYILPFDGPGGMGKTTFTQHLYNDKRVEEQFTVRVW

HMMPfam: PF00931
IPR002182
139-177 NB-ARC,NBS
NB-ARC

DETLYILPFDGPGGMGKTTFTQHLYNDKRVEEQFTVRVW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox