PRGDB00077643 (Ta.27025)

From PRG Wiki
Jump to: navigation, search
Ta.27025
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 31880060 (BT008924)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Triticum aestivum

Comment?

Triticum aestivum clone waw1c.pk002.m24:fis, full insert mRNA sequence

DNA Sequence

CCACGCGTCCGCATTCACTGTTGCGGGTCACCACTGATGATATACTGAAAGTCACAAAGAATTTCAGCAAAGAACACATCATAGGCGATGGTGGCTTTGGCACTGTCTATAAGGCGGCACTCCCTGAAGGTCGGAGAGTCGCGATCAAGAGGCTTCATGATGGCCATCAGTTCCAGGGTGACCGTGAATTCCTAGCTGAGATGGAGACCATTGGAAAGGTGAAGCATCCAAACCTTGTTCCCCTGCTTGGTTACTGTGTTTGTGGCGACGAACGGTTCCTGATCTACGAGTACATGGAGAATGGGAGCCTTGAGACATGGCTGAGGAACCGAGCAGATGCGGTTGAAGCACTTGGATGGCCAGACCGTCTCAAGATCTGCCTCGGGTCTGCCCATGGGCTTGCTTTCCTTCATGAAGGGTTTGTGCCTCATATCATCCACCGGGACATGAAATCAAGCAACATCTTGCTGGATGTAAACTTTGAGCCGAGGGTCTCTGACTTTGGCCTCGCACGGATAATCAGCGCGTGCGAGACTCATGTCAGCACCGACATCGCCGGTACATTTGGATACATCCCCCCAGAGTACGGCCAGACAATGAAGTCCAGCACGAAAGGCGACGTGTACAGCTTCGGCGTCATCATGCTGGAGCTGCTTACAGGACGGCCACCCACAGGGCAAGAAGACTTGGAAGGTGGTGGGAACCTTGTTGGCTGGGTACGATGGGTGATCGCTCGCGGAACGAGGAACGAGCTGTTTGATCCTTGCCTGCCAGTCTCAGGCATGTGGCGGGAGCAGATGGTGCGCGCGCTCAGCATCGCCCTGGACTGCACAGCCGACGAGCCGTGGAAGAGGCCAAGCATGGTGGACGTGGTGAAGGGCCTCAAGCTGACCCAGGCGATGGAGTGCGGACCTCTGGTGGTGACGGTGTCCAGGGGCGGCACGTAGAGCCGGCCTCGTAGCACTGTTCTTGACAGTGATGTGACGTAATAATGTAGGCTGATGGTAGGTAACTTGTAGCTGTAGTTGGGACAAATGCTGGAGATTGTAAAAGAGATAAACCAGTGTTGCTCATGTTCAGGCTGTAGTTGGGACAAATGCTGTTGTATCTTAATTCATGTACTGTGTGTCAGTCACTCATGGCAGCACAAGCTCTGAAGATGGTTGTGCTGaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ta.27025 translated coding region predicted by ESTScan from UniGene Ta.27025

XTRPHSLLRVTTDDILKVTKNFSKEHIIGDGGFGTVYKAALPEGRRVAIKRLHDGHQFQGDREFLAEMETIGKVKHPNLVPLLGYCVCGDERFLIYEYMENGSLETWLRNRADAVEALGWPDRLKICLGSAHGLAFLHEGFVPHIIHRDMKSSNILLDVNFEPRVSDFGLARIISACETHVSTDIAGTFGYIPPEYGQTMKSSTKGDVYSFGVIMLELLTGRPPTGQEDLEGGGNLVGWVRWVIARGTRNELFDPCLPVSGMWREQMVRALSIALDCTADEPWKRPSMVDVVKGLKLTQAMECGPLVVTVSRGGTXSRPRSTVLDSDVT

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-295 Protein kinase-like (PK-like)
Protein kinase-like domain

XTRPHSLLRVTTDDILKVTKNFSKEHIIGDGGFGTVYKAALPEGRRVAIKRLHDGHQFQGDREFLAEMETIGKVKHPNLVPLLGYCVCGDERFLIYEYMENGSLETWLRNRADAVEALGWPDRLKICLGSAHGLAFLHEGFVPHIIHRDMKSSNILLDVNFEPRVSDFGLARIISACETHVSTDIAGTFGYIPPEYGQTMKSSTKGDVYSFGVIMLELLTGRPPTGQEDLEGGGNLVGWVRWVIARGTRNELFDPCLPVSGMWREQMVRALSIALDCTADEPWKRPSMVDVVKGL

Gene3D: G3DSA:3.30.200.20
5-85 no description

HSLLRVTTDDILKVTKNFSKEHIIGDGGFGTVYKAALPEGRRVAIKRLHDGHQFQGDREFLAEMETIGKVKHPNLVPLLGY

HMMPanther: PTHR24420:SF744
6-310 SUBFAMILY NOT NAMED

SLLRVTTDDILKVTKNFSKEHIIGDGGFGTVYKAALPEGRRVAIKRLHDGHQFQGDREFLAEMETIGKVKHPNLVPLLGYCVCGDERFLIYEYMENGSLETWLRNRADAVEALGWPDRLKICLGSAHGLAFLHEGFVPHIIHRDMKSSNILLDVNFEPRVSDFGLARIISACETHVSTDIAGTFGYIPPEYGQTMKSSTKGDVYSFGVIMLELLTGRPPTGQEDLEGGGNLVGWVRWVIARGTRNELFDPCLPVSGMWREQMVRALSIALDCTADEPWKRPSMVDVVKGLKLTQAMECGPLVVTV

HMMPanther: PTHR24420
6-310 FAMILY NOT NAMED,FAMILY NOT NAMED

SLLRVTTDDILKVTKNFSKEHIIGDGGFGTVYKAALPEGRRVAIKRLHDGHQFQGDREFLAEMETIGKVKHPNLVPLLGYCVCGDERFLIYEYMENGSLETWLRNRADAVEALGWPDRLKICLGSAHGLAFLHEGFVPHIIHRDMKSSNILLDVNFEPRVSDFGLARIISACETHVSTDIAGTFGYIPPEYGQTMKSSTKGDVYSFGVIMLELLTGRPPTGQEDLEGGGNLVGWVRWVIARGTRNELFDPCLPVSGMWREQMVRALSIALDCTADEPWKRPSMVDVVKGLKLTQAMECGPLVVTV

ProfileScan: PS50011
IPR000719
22-307 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSKEHIIGDGGFGTVYKAALPEGRRVAIKRLHDGHQFQGDREFLAEMETIGKVKHPNLVPLLGYCVCGDERFLIYEYMENGSLETWLRNRADAVEALGWPDRLKICLGSAHGLAFLHEGFVPHIIHRDMKSSNILLDVNFEPRVSDFGLARIISACETHVSTDIAGTFGYIPPEYGQTMKSSTKGDVYSFGVIMLELLTGRPPTGQEDLEGGGNLVGWVRWVIARGTRNELFDPCLPVSGMWREQMVRALSIALDCTADEPWKRPSMVDVVKGLKLTQAMECGPLV

HMMSmart: SM00219
IPR020635
22-295 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSKEHIIGDGGFGTVYKAALPEGRRVAIKRLHDGHQFQGDREFLAEMETIGKVKHPNLVPLLGYCVCGDERFLIYEYMENGSLETWLRNRADAVEALGWPDRLKICLGSAHGLAFLHEGFVPHIIHRDMKSSNILLDVNFEPRVSDFGLARIISACETHVSTDIAGTFGYIPPEYGQTMKSSTKGDVYSFGVIMLELLTGRPPTGQEDLEGGGNLVGWVRWVIARGTRNELFDPCLPVSGMWREQMVRALSIALDCTADEPWKRPSMVDVVKGL

HMMSmart: SM00220
IPR002290
22-301 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSKEHIIGDGGFGTVYKAALPEGRRVAIKRLHDGHQFQGDREFLAEMETIGKVKHPNLVPLLGYCVCGDERFLIYEYMENGSLETWLRNRADAVEALGWPDRLKICLGSAHGLAFLHEGFVPHIIHRDMKSSNILLDVNFEPRVSDFGLARIISACETHVSTDIAGTFGYIPPEYGQTMKSSTKGDVYSFGVIMLELLTGRPPTGQEDLEGGGNLVGWVRWVIARGTRNELFDPCLPVSGMWREQMVRALSIALDCTADEPWKRPSMVDVVKGLKLTQAM

HMMPfam: PF00069
IPR017442
23-229 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SKEHIIGDGGFGTVYKAALPEGRRVAIKRLHDGHQFQGDREFLAEMETIGKVKHPNLVPLLGYCVCGDERFLIYEYMENGSLETWLRNRADAVEALGWPDRLKICLGSAHGLAFLHEGFVPHIIHRDMKSSNILLDVNFEPRVSDFGLARIISACETHVSTDIAGTFGYIPPEYGQTMKSSTKGDVYSFGVIMLELLTGRPPTGQED

PatternScan: PS00107
IPR017441
28-50 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGDGGFGTVYKAALPEGRRVAIK

Gene3D: G3DSA:1.10.510.10
86-299 no description

CVCGDERFLIYEYMENGSLETWLRNRADAVEALGWPDRLKICLGSAHGLAFLHEGFVPHIIHRDMKSSNILLDVNFEPRVSDFGLARIISACETHVSTDIAGTFGYIPPEYGQTMKSSTKGDVYSFGVIMLELLTGRPPTGQEDLEGGGNLVGWVRWVIARGTRNELFDPCLPVSGMWREQMVRALSIALDCTADEPWKRPSMVDVVKGLKLTQ

PatternScan: PS00108
IPR008271
145-157 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDMKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox