PRGDB00077644 (Ta.27027)

From PRG Wiki
Jump to: navigation, search
Ta.27027
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 31880054 (BT008918)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Triticum aestivum

Comment?

Triticum aestivum clone wpa1c.pk011.o13:fis, full insert mRNA sequence

DNA Sequence

GCACGAGGCCTCGTGCCGAATGTTAAGAAGGTAGACAGTGCCGCTATTTCCTTGCAGGAAGAAGATGATTTCCTTGAGGTTGTATCAAGTATGTCACGACTTAGGCATCCAAACATCGTGCCGCTTACAGGGTACTGTGTGGAGCATGCCCAAAGGCTTCTTGTTTATGAGTACATTGGAAACGCAACGCTGCATGATATGCTGCACTTCTCTGATGAGATGAGCAGAAGACTTACATGGAACATCCGTGTAAGAATAGCACTAGGCACTGCTCGGGCATTAGAATACCTGCATGAGGTTTGCTTGCCCTCTGTTGTTCATAGAAATTTTAAGTCCGCAAACATTCTACTTGATGAAGAGCATAATGCACATTTATCTGACTGTGGGCTCGCTGCCTTGACACCCAATACTGAGAGACAGGTTTCTACTGAAGTGGTTGGCTCATTTGGATACAGTGCCCCAGAGTTTTCCATGTCAGGAATTTATACTGTAAAGAGTGACGTGTACAGTTTTGGAGTAGTGATGCTAGAGCTATTGACTGGAAGGAAGCCGCTAGACAGTTCTAGAGAGAGGTCAGAACAGTCTCTTGTTAGATGGGCTACGCCTCAGCTTCATGATATCGATGCACTTTCTAAGATGGTTGATCCAGCATTAAATGGAATGTACCCTGCGAAATCGCTCTCCCGCTTTGCAGACATAATTGCACTTTGTGTTCAGCCGGAGCCAGAGTTCCGTCCTCCTATGTCTGAGGTTGTCCAGCAACTTGTGCGCCTGATGCAGAGGGCTAGCATAGTAAGGCGGCAATCAGGTGAGGAACTAGGGTTTTCTTACAGGGCTCCAGAACGTGAAGGAGAAACAAGAGACATTTCCTTCTGAGCATTTTCTTCAATGGCAAAAGTGAAAAGGTCCGAGGGTCAAATACAAGAATTGGGTGACTGCATATGAACTGGACACATGAGTTGTTCAGACAGTTGAGGATCAAATGAATTTGAGAAGATAATTTTGGTATTTACATTGTTCAATTATGCTCATTCTTCTCTTCATTTTGTTCGGGGTAGTCTACTTAACAGTTGAACTGTGTTCTCAAATCAACCGTGTGTACAGCATGTTAGTCGGGGTAGAGAAAAGAAATGTTAATGCAACAGGATAAC


Protein sequences

Name Description Sequence
Ta.27027 translated coding region predicted by ESTScan from UniGene Ta.27027

ARGLVPNVKKVDSAAISLQEEDDFLEVVSSMSRLRHPNIVPLTGYCVEHAQRLLVYEYIGNATLHDMLHFSDEMSRRLTWNIRVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEEHNAHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEELGFSYRAPEREGETRDISFXAFSSMAKVKRSEGQIQELGDCI

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-258 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ARGLVPNVKKVDSAAISLQEEDDFLEVVSSMSRLRHPNIVPLTGYCVEHAQRLLVYEYIGNATLHDMLHFSDEMSRRLTWNIRVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEEHNAHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQLVRL

HMMSmart: SM00220
IPR002290
2-262 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RGLVPNVKKVDSAAISLQEEDDFLEVVSSMSRLRHPNIVPLTGYCVEHAQRLLVYEYIGNATLHDMLHFSDEMSRRLTWNIRVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEEHNAHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQLVRLMQRA

HMMPanther: PTHR24420:SF888
3-314 OS02G0190500 PROTEIN

GLVPNVKKVDSAAISLQEEDDFLEVVSSMSRLRHPNIVPLTGYCVEHAQRLLVYEYIGNATLHDMLHFSDEMSRRLTWNIRVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEEHNAHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEELGFSYRAPEREGETRDISFXAFSSMAKVKRSEGQIQELGDCI

HMMPanther: PTHR24420
3-314 FAMILY NOT NAMED,FAMILY NOT NAMED

GLVPNVKKVDSAAISLQEEDDFLEVVSSMSRLRHPNIVPLTGYCVEHAQRLLVYEYIGNATLHDMLHFSDEMSRRLTWNIRVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEEHNAHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEELGFSYRAPEREGETRDISFXAFSSMAKVKRSEGQIQELGDCI

Gene3D: G3DSA:3.30.200.20
8-59 no description

VKKVDSAAISLQEEDDFLEVVSSMSRLRHPNIVPLTGYCVEHAQRLLVYEYI

superfamily: SSF56112
IPR011009
8-278 Protein kinase-like (PK-like)
Protein kinase-like domain

VKKVDSAAISLQEEDDFLEVVSSMSRLRHPNIVPLTGYCVEHAQRLLVYEYIGNATLHDMLHFSDEMSRRLTWNIRVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEEHNAHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQLVRLMQRASIVRRQSGEELGFSYR

HMMPfam: PF07714
IPR001245
8-255 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

VKKVDSAAISLQEEDDFLEVVSSMSRLRHPNIVPLTGYCVEHAQRLLVYEYIGNATLHDMLHFSDEMSRRLTWNIRVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEEHNAHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQL

HMMSmart: SM00219
IPR020635
8-255 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VKKVDSAAISLQEEDDFLEVVSSMSRLRHPNIVPLTGYCVEHAQRLLVYEYIGNATLHDMLHFSDEMSRRLTWNIRVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEEHNAHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQL

Gene3D: G3DSA:1.10.510.10
63-255 no description

TLHDMLHFSDEMSRRLTWNIRVRIALGTARALEYLHEVCLPSVVHRNFKSANILLDEEHNAHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox