PRGDB00077645 (Ta.27258)

From PRG Wiki
Jump to: navigation, search
Ta.27258
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 32128937 (BT009386)
Gene Class Unknown
Domain Type LRR
Gene Species Triticum aestivum

Comment?

Triticum aestivum clone wlm96.pk034.m17:fis, full insert mRNA sequence

DNA Sequence

CTCGTGCCGAATTCGGCACGAGCACGGTTCCAGCAATGGCAGCTCAGACCGGAGCAGTGCTCCTCCTCGTCGGCCTCCTTGCTCTTGCAACCATGGCCAGCAGCAACACTGAAGGCGACATCCTTTACTCGCAAAGGCAGGTGTGGAAGGATCCCAACAACGTTCTGACAAGCTGGGATCCGACGCTTGTCAACCCCTGCACTTGGTTCCATGTCACCTGCAACCTCGACAACTCCGTCACCCGAGTGGATTTGGGGAACGCAGGCATCTCAGGCACCCTGATTCCTCAACTGGGACAACTGAAGAACCTGCAGTACCTGGAGCTATACGGGAACAATATGAGTGGACCAATACCAACGACCCTGGGCAACCTGACACGCCTGGTCAGCCTTGATCTCTACGACAACCATCTCACCGGAGTGATACCTTCCTCGCTTGGGGCAGTTGGGACACTGCGTTTCTTGAGGTTGCATGGGAACAAACTGGCAGGGAGTATACCGGCGTCGTTGGGCCGTCTGACGAAGCTTGTCAAGCTGGAGCTTCAGGAGAACATGCTGAGCGGCACGGTGCCGCTGGAGATCCTCTCACTTGTTCTTGTTGGGGACTTGACTGAACTGAATGTCGCCAAGAACAATCTTGCCGGCACTGTCATATCATCTAAACCAAGAGTGGCTACGGTCATCCATGACACGCTCAAGACTACAAGCTGAACACTAGTGGCAACCTAAACTTTTGTAAGAATAAACTAAATGATTTCTAATTCTGAAATGGCTGGCAGTAGCTGTAGCTGCGGCCTGAGCTTTTGTAGACCTCTATTCTGGTAAGGCTCCGGGGACTTACCTCCGTTTCAAGAAAAAAGAGGAAGTTGTGGTTGAAAGCATTGTAATTACTAGCAACCTTTACCCGCATATCCTGTGTAATCTATTTGGTGTCGTGTCTCACTATAAACTATAAAAACCCTTGCCCCCaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ta.27258 translated coding region predicted by ESTScan from UniGene Ta.27258

XRAEFGTSTVPAMAAQTGAVLLLVGLLALATMASSNTEGDILYSQRQVWKDPNNVLTSWDPTLVNPCTWFHVTCNLDNSVTRVDLGNAGISGTLIPQLGQLKNLQYLELYGNNMSGPIPTTLGNLTRLVSLDLYDNHLTGVIPSSLGAVGTLRFLRLHGNKLAGSIPASLGRLTKLVKLELQENMLSGTVPLEILSLVLVGDLTELNVAKNNLAGTVISSKPRVATVIHDTLKTTS


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF610
1-228 OS11G0514700 PROTEIN

XRAEFGTSTVPAMAAQTGAVLLLVGLLALATMASSNTEGDILYSQRQVWKDPNNVLTSWDPTLVNPCTWFHVTCNLDNSVTRVDLGNAGISGTLIPQLGQLKNLQYLELYGNNMSGPIPTTLGNLTRLVSLDLYDNHLTGVIPSSLGAVGTLRFLRLHGNKLAGSIPASLGRLTKLVKLELQENMLSGTVPLEILSLVLVGDLTELNVAKNNLAGTVISSKPRVATVI

HMMPanther: PTHR24420
1-228 FAMILY NOT NAMED,FAMILY NOT NAMED

XRAEFGTSTVPAMAAQTGAVLLLVGLLALATMASSNTEGDILYSQRQVWKDPNNVLTSWDPTLVNPCTWFHVTCNLDNSVTRVDLGNAGISGTLIPQLGQLKNLQYLELYGNNMSGPIPTTLGNLTRLVSLDLYDNHLTGVIPSSLGAVGTLRFLRLHGNKLAGSIPASLGRLTKLVKLELQENMLSGTVPLEILSLVLVGDLTELNVAKNNLAGTVISSKPRVATVI

Seg: seg
14-33 seg

AAQTGAVLLLVGLLALATMA

superfamily: SSF52058
32-216 L domain-like,LRR

MASSNTEGDILYSQRQVWKDPNNVLTSWDPTLVNPCTWFHVTCNLDNSVTRVDLGNAGISGTLIPQLGQLKNLQYLELYGNNMSGPIPTTLGNLTRLVSLDLYDNHLTGVIPSSLGAVGTLRFLRLHGNKLAGSIPASLGRLTKLVKLELQENMLSGTVPLEILSLVLVGDLTELNVAKNNLAGT

HMMPfam: PF08263
IPR013210
36-75 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NTEGDILYSQRQVWKDPNNVLTSWDPTLVNPCTWFHVTCN

Gene3D: G3DSA:3.80.10.10
37-217 no description

TEGDILYSQRQVWKDPNNVLTSWDPTLVNPCTWFHVTCNLDNSVTRVDLGNAGISGTLIPQLGQLKNLQYLELYGNNMSGPIPTTLGNLTRLVSLDLYDNHLTGVIPSSLGAVGTLRFLRLHGNKLAGSIPASLGRLTKLVKLELQENMLSGTVPLEILSLVLVGDLTELNVAKNNLAGTV

HMMPfam: PF12799
102-140 LRR_4,Leucine Rich repeats (2 copies)

KNLQYLELYGNNMSGPIPTTLGNLTRLVSLDLYDNHLTG

HMMPfam: PF00560
IPR001611
152-173 LRR_1
Leucine-rich repeat

LRFLRLHGNKLAGSIPASLGRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox