PRGDB00077646 (Ta.27314)

From PRG Wiki
Jump to: navigation, search
Ta.27314
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 32128949 (BT009398)
Gene Class Unknown
Domain Type LRR
Gene Species Triticum aestivum

Comment?

Triticum aestivum clone wlm96.pk042.k21:fis, full insert mRNA sequence

DNA Sequence

GCACGAGGCGGCTCTGACCGGTGCAGCGCTCCTCCTCGCCAGCCTCCTTGCTCTTGCAGCCATAGCCAGCGGCAACACCGAAGGTGACATCCTCTACTCGCAAAGGCTGGCGTGGAAGGACCCCAACAACGTGCTGCAGAGCTGGGATCCCACCCTTGTCAACCCCTGCACTTGGTTCCATGTCACCTGCAACAACGTCAACAACGTCAACTCCGTCATCCGAGTGGACTTGGGGAATGCAGGCCTCTCAGGCGCCCTGGTTCCTGGACTGGGACGAATGGTGAACCTTCAGTACCTGGAGCTGTTTGGGAACAATATCAGTGGACCGATTCCAGCAACCCTCGGCAACCTGACACGCCTGGTCAGCCTTGATCTCTACGACAACCATCTCACCGGCGCGATACCAGCCTCGCTCGGGAACATCGGGACGCTGCGTTTCCTGAGGCTGCACGGGAACAAGTTTGCAGGTGGTATACCGTCGTCGTTGGGCCGTCTGACGAAGCTTCAAACTTTGGAGCTTCAGGAGAACATGCTGACCGGCACAGTGCCGCTGGAAGTCCTCTCTCTTGTTCTTCTTGGGGACTTGACTGAACTTAACGTTGCCAAGAACAGTCTGGCCGGCACTGTCAAATCATCTAAACCAAGAGTAGCTACCGTCATCCAGGACACGCTCAAGACTACACGTCTACATGCTGAGCAGCACTGACAACCTGAACTTTTCTAAGAATAAACTGAATGtttttttccttttGAAACTGCTGGAAGAGGCTGTAGCCTTTTATTCCGTTAAGAGCCCCTAGCTTACATCCATTTCTAGAGAGAAAAAGGGAAAAGGTGAAAGGTAGTTGAATACATTGTAATCAGTGCAACTTCATAATAATGAATCTTTCTCTGCACCTTTAGTGCATATCCAGTGTTaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ta.27314 translated coding region predicted by ESTScan from UniGene Ta.27314

XHEAALTGAALLLASLLALAAIASGNTEGDILYSQRLAWKDPNNVLQSWDPTLVNPCTWFHVTCNNVNNVNSVIRVDLGNAGLSGALVPGLGRMVNLQYLELFGNNISGPIPATLGNLTRLVSLDLYDNHLTGAIPASLGNIGTLRFLRLHGNKFAGGIPSSLGRLTKLQTLELQENMLTGTVPLEVLSLVLLGDLTELNVAKNSLAGTVKSSKPRVATVIQDTLKTTRLHAEQH

Domains

Domain Start-End Description Sequence

Seg: seg
4-23 seg

AALTGAALLLASLLALAAIA

HMMPanther: PTHR24420:SF610
11-210 OS11G0514700 PROTEIN

LLLASLLALAAIASGNTEGDILYSQRLAWKDPNNVLQSWDPTLVNPCTWFHVTCNNVNNVNSVIRVDLGNAGLSGALVPGLGRMVNLQYLELFGNNISGPIPATLGNLTRLVSLDLYDNHLTGAIPASLGNIGTLRFLRLHGNKFAGGIPSSLGRLTKLQTLELQENMLTGTVPLEVLSLVLLGDLTELNVAKNSLAGTV

HMMPanther: PTHR24420
11-210 FAMILY NOT NAMED,FAMILY NOT NAMED

LLLASLLALAAIASGNTEGDILYSQRLAWKDPNNVLQSWDPTLVNPCTWFHVTCNNVNNVNSVIRVDLGNAGLSGALVPGLGRMVNLQYLELFGNNISGPIPATLGNLTRLVSLDLYDNHLTGAIPASLGNIGTLRFLRLHGNKFAGGIPSSLGRLTKLQTLELQENMLTGTVPLEVLSLVLLGDLTELNVAKNSLAGTV

superfamily: SSF52058
22-209 L domain-like,LRR

IASGNTEGDILYSQRLAWKDPNNVLQSWDPTLVNPCTWFHVTCNNVNNVNSVIRVDLGNAGLSGALVPGLGRMVNLQYLELFGNNISGPIPATLGNLTRLVSLDLYDNHLTGAIPASLGNIGTLRFLRLHGNKFAGGIPSSLGRLTKLQTLELQENMLTGTVPLEVLSLVLLGDLTELNVAKNSLAGT

HMMPfam: PF08263
IPR013210
26-65 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NTEGDILYSQRLAWKDPNNVLQSWDPTLVNPCTWFHVTCN

Gene3D: G3DSA:3.80.10.10
28-212 no description

EGDILYSQRLAWKDPNNVLQSWDPTLVNPCTWFHVTCNNVNNVNSVIRVDLGNAGLSGALVPGLGRMVNLQYLELFGNNISGPIPATLGNLTRLVSLDLYDNHLTGAIPASLGNIGTLRFLRLHGNKFAGGIPSSLGRLTKLQTLELQENMLTGTVPLEVLSLVLLGDLTELNVAKNSLAGTVKS

Seg: seg
62-76 seg

VTCNNVNNVNSVIRV

HMMPfam: PF12799
96-132 LRR_4,Leucine Rich repeats (2 copies)

NLQYLELFGNNISGPIPATLGNLTRLVSLDLYDNHLT

HMMPfam: PF13504
144-155 LRR_7,Leucine rich repeat

TLRFLRLHGNKF

Seg: seg
185-199 seg

LEVLSLVLLGDLTEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox