PRGDB00077647 (Ta.27345)

From PRG Wiki
Jump to: navigation, search
Ta.27345
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 32128993 (BT009442)
Gene Class Mlo-like
Domain Type MLO
Gene Species Triticum aestivum

Comment?

Triticum aestivum clone wlmk4.pk0025.f7:fis, full insert mRNA sequence

DNA Sequence

GCACGAGGAGTACGTTTGGGGCGCCATGGCCGGCGGTGGAGGGAAGGCCAAGCCGCTCGAGTACACGCCGACATGGATCGTGGCGTTGGTCTGCTCCGTCATGATCATCATCTCCCTGCTCTTCGAGCGCTTGCTCCACCGCCTAGGCAAGAGGCTGATAAGGAGCCGTAAGAAGCCGCTGTACGAGGCCCTCCTGAAGGTGAAGGAGGAGCTGATGCTGCTGGGGTTCATCTCGCTGCTGCTCACCGTGTTCCAGGGTCCCATGGGGAAGGTGTGCGTCAGCCCGAGCGCCATGCTCCACCTGCAGCCCTGCAAGCCGCCGCCGCACGAGACGGACCACCTCGGCGACGCCGTGTTCACCGGCGTGCTGGGTGGGGCGAGGCGCCTCCTGGCTGGAGGAGCCTCCTCCTCCGACAAATACTGCCTCAAGAAGGACAAAGTTCCATTACTTTCATCTGACGCTATTCATCAATTGCACATATTTATCTTTGTGTTGGCGGTCACCCATTTCCTTCTCAGTGCTATTACAGTTCTTCTAGGAATGGCACAGACGAGAAATTGGCGACATTGGGAGACCAAGATCCAAGAAAATAATGGCAGTGCACCTCAAATGATCAAGCATGTTCAAGAATTCAAATTTATTCAAGACCACTTCAAAGGTCATAGAAAACGGTCGAGGATATTTGGTTGGATGCGTTCCTTCTTCAAACAATTGTATGGATCGGTCACCGAGGAGGACTACACAACAATGAGACTTGGTTTCATCATGAAACACTGTAAGGGAACACCAAAATTCAACTTTTATAGTTACATGATCAGGGCTTTGGAGGTTGACTTTAAGAAAGTCGTTGGTATTAGTTGGTACCTTTGGGCCATGTTGATGATATTCCTACTATTGAATGTTGAAGGGTGGTATGTCTACATTTGGATCACCTTGGTTCCATTCATTATGTTACTTATGGTAGGAAGTAAGATGGAGCACATCATAACGGAATTGGCTTATGAGGTTGCCCAGAAGCACACGGCTATTCGAGGGGATTTAGTAGTTTCTCCTTCAGATAACTTCTTTTGGTTCCACCGGCCTAAATTAGTTCTTCTGTTGATCCACATCGTGCTATTTCAGAATGCATTTGAAATTGCATTTTTCTTCTGGCTCTTGGTGACATATGGTTTTAAATCATGCATCATGGGGAAACCAGCATATGTTATTACTCGAGTTGTCATAAGTGTAATCTGCCAAGTCCTTTGTGGTTACAGCACCCTACCACTATACGCCGTCGTCTCCCATATGGGGAATTCCTTCAAGAAGACTATATTTGATGAAAATGTGACTGAAGGCCTTGTCAACTGGGCTGAAAAGGCTAGGAGAGGCACAAGAACCCCAAATAAAATTACTACAGATGCAAGTAGTTCACCAATTGATGAGGCAAATGGTGGCGCGGTTCAAATGACAAATACACGGGCAAACTCGTCGGTGGAGCAAGGCACCGCTAGGTTGATATAATCATGTACATTAGTTGCTAATACAAAGGGTCCATGGGCAACAATTTTGGCAAGTGGACAGATTTATTTTTTGAGGGCATCACATATCTTTAATAATGCACGGGAATCATGTGTTCCCGTTTTTAAACCAAAAAGAGAAATAACCCCCCTCTAAAAAGAAACA


Protein sequences

Name Description Sequence
Ta.27345 translated coding region predicted by ESTScan from UniGene Ta.27345

ARGVRLGRHGRRWREGQAARVHADMDRGVGLLRHDHHLPALRALAPPPRQEADKEPXEAAVRGPPEGEGGADAAGVHLAAAHRVPGSHGEGVRQPERHAPPAALQAAAARDGPPRRRRVHRRAGWGEAPPGGGASSSDKYCLKKDKVPLLSSDAIHQLHIFIFVLAVTHFLLSAITVLLGMAQTRNWRHWETKIQENNGSAPQMIKHVQEFKFIQDHFKGHRKRSRIFGWMRSFFKQLYGSVTEEDYTTMRLGFIMKHCKGTPKFNFYSYMIRALEVDFKKVVGISWYLWAMLMIFLLLNVEGWYVYIWITLVPFIMLLMVGSKMEHIITELAYEVAQKHTAIRGDLVVSPSDNFFWFHRPKLVLLLIHIVLFQNAFEIAFFFWLLVTYGFKSCIMGKPAYVITRVVISVICQVLCGYSTLPLYAVVSHMGNSFKKTIFDENVTEGLVNWAEKARRGTRTPNKITTDASSSPIDEANGGAVQMTNTRANSSVEQGTARLI

Domains

Domain Start-End Description Sequence

Seg: seg
31-49 seg

LLRHDHHLPALRALAPPPR

Seg: seg
63-81 seg

GPPEGEGGADAAGVHLAAA

Seg: seg
99-137 seg

APPAALQAAAARDGPPRRRRVHRRAGWGEAPPGGGASSS

HMMPfam: PF03094
IPR004326
133-477 Mlo
Mlo-related protein

GASSSDKYCLKKDKVPLLSSDAIHQLHIFIFVLAVTHFLLSAITVLLGMAQTRNWRHWETKIQENNGSAPQMIKHVQEFKFIQDHFKGHRKRSRIFGWMRSFFKQLYGSVTEEDYTTMRLGFIMKHCKGTPKFNFYSYMIRALEVDFKKVVGISWYLWAMLMIFLLLNVEGWYVYIWITLVPFIMLLMVGSKMEHIITELAYEVAQKHTAIRGDLVVSPSDNFFWFHRPKLVLLLIHIVLFQNAFEIAFFFWLLVTYGFKSCIMGKPAYVITRVVISVICQVLCGYSTLPLYAVVSHMGNSFKKTIFDENVTEGLVNWAEKARRGTRTPNKITTDASSSPIDEAN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox