PRGDB00077649 (Ta.27859)

From PRG Wiki
Jump to: navigation, search
Ta.27859
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 63175647 (DQ013358)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Triticum aestivum

Comment?

Triticum aestivum wall-associated kinase 4 (WAK4) mRNA, complete cds

DNA Sequence

TAGCAAGTGAGCAGAAGATACACCACGATGGCTCCACCGGCGAAACTGACCCAGTATACCCAGCTGATCCTACTCCTCCTTGCAGCAGCAGTAGCTAGTGATCACTTGACCCTGCAGCAGGCTGCGGCTGCCGCCGATGAATTACAAGGCCGACCGCAGCAGGGGCTGGGGCGTCCGGGTTGCCGGGACAAGTGCGGCGACATGAGCATCCCGTTCCCCTTCGGCATGGACAAGCCCGGCTGCTTCCTACCCGGCTTCGAGGTCACCTGCAACACCTCCTCCACTCCGCCTCGCGCCTTCCTCGCCTACAACCACAGCGAGCCACCATACCAGGTGATTTACCAGTATGCATTCGACACTGAGAGTGGGGCTACAAGCCAAATAGAGGGGCGTCAGGCGGTCGAGCTGTTCGACATATCACTCGAGACGAGCGAGGTACGTGTGTACAGCGGCGTCAATTCCCGGTGCTTCACAAACGATTCCGCGGGTTTAGACAAGGGTGAATACATGGAGTTGGACAGGGAGGGGCCGTTCCTCCTGTCGTCGACGCGCGACGATCTCGTCGGCGTCGGCTGGAACGCCGAGCCCTCCATGACATACACGGTCAAGGCCTCGCCGGGCCCTCTCTCCTGCACTTCAAACCTTCCCTTCATGTTTGCGGCCAAAGATGGGGTGTGCTCGGGTCTGGGCTGCTGTCAGATTGCCCTGCCGCCGCAGATACCGACTCTCCCTGTCATCAGTACCGGGTTGATCTTGAAGAATTACATCAATATTCGCTGGGAAACCAATCCATGCTCCTACGGCATGGTGGTGGAGAGGTCATGGTACAACTTCACGGAGGAGGACTTGTACGGCTACGAGGTGTTATCTACGAAACTCAGCAGGGGCTTCCCGTTGGTGCTTGATTTCGCCATCAGGGACGGCTCGTGTGAGCGCGACGGCTGCCTCAGCGGCAACAGTTCTTGTGCCAAAGCAGCCGGAGGCTATGTCTGCAAGTGCCGGGAGCATTACAATGGCAACCCCTACATCACCGATGGATGCCAAGACATCGATGAATGTCAGCTCCGAGAACAGAGTCCCGAGTTCCGAGATTTATATCCGTGTGACGGGATCTGCACCAACATACCCGGAGGATATGACTGCCGATGCAAACGCGGGATGAAAGGCGACGCCAAAAAGGGAAACTGCGCCGAAATTTTTCCCCTGTCAGCAAAGATCATCGTTGGTCTTGCTGGATGGATTGTTGTCTTTGTCATCATTATTATGGCCAAGCAACACCTAAAACTTAAGAAGTTCTATGCACAAAATGGTGGTCCAATACTTAATGGTGTCAAGAATATACGGGTATACACGAGGAAACAGCTGAAACAAGTAACAAGCAACTATGAGTGTGTCATTGGACAGGGCCACTTTGGTAAGGTTTATAAGGGCACTCTGAAAGATAAACAACAAGTGGCTGTGAAGAAGTCCATCAAAGTTGACAAGGACATGAAGAAGGAATTCACCGATGAGGTTATAATCCAATCCGAGATGAGGCACAAAAACATTGTCAGGCTCCTAGGTTGTTGCCTAGAGTTCGATGTTCCCATGTTGGTGTAAGAGTTTGTGGCGAAAGGGAGTTTGTATGATGCCCTCTTCAAAAGGAAGGATAGCATTCCAGTGAACAAGCGCCTTGCAATTGCTATTGGGTCAGCTGAAGGCCTAACATATATGCACTCGGCTGGGGAGAGTACGATACGTCACGGTGATGTTAAATCTGCAAACATTCTTCTTGATGAACATTTCACCCCAAAAGTTTCAGACTTTGGTACCTCGAAGTTGTTCGCAAAAGGAAAAGACGAGGAGACTGATCGTGTTATTGGGGACATGAGTTACATAGATCCAATATATATGGAGAAGGGGGTCATTACACAAAAGAGTGATGTCTACAGTTTTGGAATTGTTCTCATAGAGCTCATCACAAGAAGACCTGCAACATATGACGTCAAGAGGAGCTATGTTGCAAACTTTGTTCAATCTTGTGCAGAAAAAAGAGTAAGGAACTTTATTGATAACGATATTACAAGTGAGGTTGATATTGCTATGTTGGAAATGGTTAGTGGGGTTGCTGCAGATTGTCTAAAACCTAATCCAGAAGAATGGCATGATATGAAACAAGTAGAACACCGGCTCCTCAAAATTATTGGACAACCCGTATATCATGGTCAGAAGGGAAACTCCCAGTTAGATCTTCGTCCTGCACCTGATCATGTTGCTTTGCTTAGCTAACATGTTGCATTTTCATTTGGTTATGTAATGTGGTTTCTTT


Protein sequences

Name Description Sequence
Ta.27859 translated coding region predicted by ESTScan from UniGene Ta.27859

MAPPAKLTQYTQLILLLLAAAVASDHLTLQQAAAAADELQGRPQQGLGRPGCRDKCGDMSIPFPFGMDKPGCFLPGFEVTCNTSSTPPRAFLAYNHSEPPYQVIYQYAFDTESGATSQIEGRQAVELFDISLETSEVRVYSGVNSRCFTNDSAGLDKGEYMELDREGPFLLSSTRDDLVGVGWNAEPSMTYTVKASPGPLSCTSNLPFMFAAKDGVCSGLGCCQIALPPQIPTLPVISTGLILKNYINIRWETNPCSYGMVVERSWYNFTEEDLYGYEVLSTKLSRGFPLVLDFAIRDGSCERDGCLSGNSSCAKAAGGYVCKCREHYNGNPYITDGCQDIDECQLREQSPEFRDLYPCDGICTNIPGGYDCRCKRGMKGDAKKGNCAEIFPLSAKIIVGLAGWIVVFVIIIMAKQHLKLKKFYAQNGGPILNGVKNIRVYTRKQLKQVTSNYECVIGQGHFGKVYKGTLKDKQQVAVKKSIKVDKDMKKEFTDEVIIQSEMRHKNIVRLLGCCLEFDVPMLVXEFVAKGSLYDALFKRKDSIPVNKRLAIAIGSAEGLTYMHSAGESTIRHGDVKSANILLDEHFTPKVSDFGTSKLFAKGKDEETDRVIGDMSYIDPIYMEKGVITQKSDVYSFGIVLIELITRRPATYDVKRSYVANFVQSCAEKRVRNFIDNDITSEVDIAMLEMVSGVAADCLKPNPEEWHDMKQVEHRLLKIIGQPVYHGQKGNSQLDLRPAPDHVALLS

Domains

Domain Start-End Description Sequence

Seg: seg
13-23 seg

LILLLLAAAVA

Seg: seg
30-36 seg

QQAAAAA

Seg: seg
39-51 seg

LQGRPQQGLGRPG

HMMPfam: PF13947
IPR025287
50-184 GUB_WAK_bind
Wall-associated receptor kinase galacturonan-bindi

PGCRDKCGDMSIPFPFGMDKPGCFLPGFEVTCNTSSTPPRAFLAYNHSEPPYQVIYQYAFDTESGATSQIEGRQAVELFDISLETSEVRVYSGVNSRCFTNDSAGLDKGEYMELDREGPFLLSSTRDDLVGVGWN

superfamily: SSF57196
299-356 EGF/Laminin

GSCERDGCLSGNSSCAKAAGGYVCKCREHYNGNPYITDGCQDIDECQLREQSPEFRDL

HMMSmart: SM00181
IPR006210
300-339 Epidermal growth factor-like domain.
Epidermal growth factor-like

SCERDGCLSGNSSCAKAAGGYVCKCREHYNGNPYITDGCQ

Gene3D: G3DSA:2.10.25.10
301-387 no description

CERDGCLSGNSSCAKAAGGYVCKCREHYNGNPYITDGCQDIDECQLREQSPEFRDLYPCDGICTNIPGGYDCRCKRGMKGDAKKGNC

HMMPanther: PTHR24420:SF444
306-718 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

CLSGNSSCAKAAGGYVCKCREHYNGNPYITDGCQDIDECQLREQSPEFRDLYPCDGICTNIPGGYDCRCKRGMKGDAKKGNCAEIFPLSAKIIVGLAGWIVVFVIIIMAKQHLKLKKFYAQNGGPILNGVKNIRVYTRKQLKQVTSNYECVIGQGHFGKVYKGTLKDKQQVAVKKSIKVDKDMKKEFTDEVIIQSEMRHKNIVRLLGCCLEFDVPMLVXEFVAKGSLYDALFKRKDSIPVNKRLAIAIGSAEGLTYMHSAGESTIRHGDVKSANILLDEHFTPKVSDFGTSKLFAKGKDEETDRVIGDMSYIDPIYMEKGVITQKSDVYSFGIVLIELITRRPATYDVKRSYVANFVQSCAEKRVRNFIDNDITSEVDIAMLEMVSGVAADCLKPNPEEWHDMKQVEHRLLKI

HMMPanther: PTHR24420
306-718 FAMILY NOT NAMED,FAMILY NOT NAMED

CLSGNSSCAKAAGGYVCKCREHYNGNPYITDGCQDIDECQLREQSPEFRDLYPCDGICTNIPGGYDCRCKRGMKGDAKKGNCAEIFPLSAKIIVGLAGWIVVFVIIIMAKQHLKLKKFYAQNGGPILNGVKNIRVYTRKQLKQVTSNYECVIGQGHFGKVYKGTLKDKQQVAVKKSIKVDKDMKKEFTDEVIIQSEMRHKNIVRLLGCCLEFDVPMLVXEFVAKGSLYDALFKRKDSIPVNKRLAIAIGSAEGLTYMHSAGESTIRHGDVKSANILLDEHFTPKVSDFGTSKLFAKGKDEETDRVIGDMSYIDPIYMEKGVITQKSDVYSFGIVLIELITRRPATYDVKRSYVANFVQSCAEKRVRNFIDNDITSEVDIAMLEMVSGVAADCLKPNPEEWHDMKQVEHRLLKI

superfamily: SSF57196
338-390 EGF/Laminin

CQDIDECQLREQSPEFRDLYPCDGICTNIPGGYDCRCKRGMKGDAKKGNCAEI

PatternScan: PS01187
IPR018097
340-372 EGF_CA
EGF-like calcium-binding, conserved site

DIDECQLREQSPEFRDLYPCDGICTNIPGGYDC

HMMSmart: SM00179
IPR001881
340-388 Calcium-binding EGF-like domain
EGF-like calcium-binding

DIDECQLREQSPEFRDLYPCDGICTNIPGGYDCRCKRGMKGDAKKGNCA

HMMSmart: SM00181
IPR006210
343-388 Epidermal growth factor-like domain.
Epidermal growth factor-like

ECQLREQSPEFRDLYPCDGICTNIPGGYDCRCKRGMKGDAKKGNCA

superfamily: SSF56112
IPR011009
425-715 Protein kinase-like (PK-like)
Protein kinase-like domain

AQNGGPILNGVKNIRVYTRKQLKQVTSNYECVIGQGHFGKVYKGTLKDKQQVAVKKSIKVDKDMKKEFTDEVIIQSEMRHKNIVRLLGCCLEFDVPMLVXEFVAKGSLYDALFKRKDSIPVNKRLAIAIGSAEGLTYMHSAGESTIRHGDVKSANILLDEHFTPKVSDFGTSKLFAKGKDEETDRVIGDMSYIDPIYMEKGVITQKSDVYSFGIVLIELITRRPATYDVKRSYVANFVQSCAEKRVRNFIDNDITSEVDIAMLEMVSGVAADCLKPNPEEWHDMKQVEHRL

Gene3D: G3DSA:3.30.200.20
437-513 no description

NIRVYTRKQLKQVTSNYECVIGQGHFGKVYKGTLKDKQQVAVKKSIKVDKDMKKEFTDEVIIQSEMRHKNIVRLLGC

ProfileScan: PS50011
IPR000719
451-716 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

SNYECVIGQGHFGKVYKGTLKDKQQVAVKKSIKVDKDMKKEFTDEVIIQSEMRHKNIVRLLGCCLEFDVPMLVXEFVAKGSLYDALFKRKDSIPVNKRLAIAIGSAEGLTYMHSAGESTIRHGDVKSANILLDEHFTPKVSDFGTSKLFAKGKDEETDRVIGDMSYIDPIYMEKGVITQKSDVYSFGIVLIELITRRPATYDVKRSYVANFVQSCAEKRVRNFIDNDITSEVDIAMLEMVSGVAADCLKPNPEEWHDMKQVEHRLL

HMMSmart: SM00219
IPR020635
451-715 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

SNYECVIGQGHFGKVYKGTLKDKQQVAVKKSIKVDKDMKKEFTDEVIIQSEMRHKNIVRLLGCCLEFDVPMLVXEFVAKGSLYDALFKRKDSIPVNKRLAIAIGSAEGLTYMHSAGESTIRHGDVKSANILLDEHFTPKVSDFGTSKLFAKGKDEETDRVIGDMSYIDPIYMEKGVITQKSDVYSFGIVLIELITRRPATYDVKRSYVANFVQSCAEKRVRNFIDNDITSEVDIAMLEMVSGVAADCLKPNPEEWHDMKQVEHRL

HMMSmart: SM00220
IPR002290
451-716 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

SNYECVIGQGHFGKVYKGTLKDKQQVAVKKSIKVDKDMKKEFTDEVIIQSEMRHKNIVRLLGCCLEFDVPMLVXEFVAKGSLYDALFKRKDSIPVNKRLAIAIGSAEGLTYMHSAGESTIRHGDVKSANILLDEHFTPKVSDFGTSKLFAKGKDEETDRVIGDMSYIDPIYMEKGVITQKSDVYSFGIVLIELITRRPATYDVKRSYVANFVQSCAEKRVRNFIDNDITSEVDIAMLEMVSGVAADCLKPNPEEWHDMKQVEHRLL

HMMPfam: PF00069
IPR017442
456-712 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

VIGQGHFGKVYKGTLKDKQQVAVKKSIKVDKDMKKEFTDEVIIQSEMRHKNIVRLLGCCLEFDVPMLVXEFVAKGSLYDALFKRKDSIPVNKRLAIAIGSAEGLTYMHSAGESTIRHGDVKSANILLDEHFTPKVSDFGTSKLFAKGKDEETDRVIGDMSYIDPIYMEKGVITQKSDVYSFGIVLIELITRRPATYDVKRSYVANFVQSCAEKRVRNFIDNDITSEVDIAMLEMVSGVAADCLKPNPEEWHDMKQVE

PatternScan: PS00107
IPR017441
457-480 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGQGHFGKVYKGTLKDKQQVAVKK

Seg: seg
478-490 seg

VKKSIKVDKDMKK

Gene3D: G3DSA:1.10.510.10
514-713 no description

CLEFDVPMLVXEFVAKGSLYDALFKRKDSIPVNKRLAIAIGSAEGLTYMHSAGESTIRHGDVKSANILLDEHFTPKVSDFGTSKLFAKGKDEETDRVIGDMSYIDPIYMEKGVITQKSDVYSFGIVLIELITRRPATYDVKRSYVANFVQSCAEKRVRNFIDNDITSEVDIAMLEMVSGVAADCLKPNPEEWHDMKQVEH

PatternScan: PS00108
IPR008271
570-582 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IRHGDVKSANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox