PRGDB00077694 (Ta.33376)

From PRG Wiki
Jump to: navigation, search
Ta.33376
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 55609682 (CV766418)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

FGAS060805 Triticum aestivum FGAS: Library 2 Gate 3 Triticum aestivum cDNA, mRNA sequence

DNA Sequence

aagcttgaccttaggcctatttaggtgacactactagaacaagtttgtacaaaaaagcaggctggtaccggtccggaattcccgggatatcgtcgacCCACGCGTCCGCTGAGGACAGGGAGTCAGCTTCTCATGTCCTTCACGAGTGGCTGGACTGTTTGAAGGATGCGGTCTATGACATAGATGATCTTTTGGACGATGCGTCCACCGAAGCTCTCATGTTACATGTTCATAAGGGTTTATCTCGCATTGAGTCTATGAGCCTTCTCGTTACTGGTCCATTCAAATTGAGTCACAAAATAGAACAAGTTCGTAAAAAGCTTGATGAGATAGCAAAGGACAGAGGGCAATTTGGTTTAAATGAGCAACCAATTATTGACAGACGGATGTTCAGGAGTAGCAACAGGGAAACTCATTCCTTCATCACCGAATCAGATATTATTGGAAGAGCTGAAGCCAAAAACAAGATAATTGAAAAGATATTGACAGCTAAAGACTCAAAACCCTTGTCTGTTCTTCCGATTGTCGGTTTAGGAGGAATTGGAAAAACTGCTTTAGCAAAATGGATTTACAATGATGTTCAGGTTACCCAGAATTTTGAGATGAAATTATGGGTTTGTGTATCTGATGTGTTCAATTTAAAAAAGATCTTGGATGATATAATACAATCAGGTACAGGTGAAAGCAACATGAAGCTAAATCTAGAGATGCTGCANAGGAAGTTGTGTGCACTTTTGAAGGANAGAGATATTTTCTAGTCCTAGATGACCTCTGGAATGATAAACTTGCAGACTGGGAAGAGCTGAGAGGCTGCTATCTAGTGG


Protein sequences

Name Description Sequence
Ta.33376 translated coding region predicted by ESTScan from UniGene Ta.33376

KLDLRPXLGDTTRTSLYKKAGWYRSGIPGISSTHASAEDRESASHVLHEWLDCLKDAVYDIDDLLDDASTEALMLHVHKGLSRIESMSLLVTGPFKLSHKIEQVRKKLDEIAKDRGQFGLNEQPIIDRRMFRSSNRETHSFITESDIIGRAEAKNKIIEKILTAKDSKPLSVLPIVGLGGIGKTALAKWIYNDVQVTQNFEMKLWVCVSDVFNLKKILDDIIQSGTGXKQHEAKSRDAAXEVVCTFEGXRYFLVLDDLWNDKLADWEELRGCYLVX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
37-270 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

AEDRESASHVLHEWLDCLKDAVYDIDDLLDDASTEALMLHVHKGLSRIESMSLLVTGPFKLSHKIEQVRKKLDEIAKDRGQFGLNEQPIIDRRMFRSSNRETHSFITESDIIGRAEAKNKIIEKILTAKDSKPLSVLPIVGLGGIGKTALAKWIYNDVQVTQNFEMKLWVCVSDVFNLKKILDDIIQSGTGXKQHEAKSRDAAXEVVCTFEGXRYFLVLDDLWNDKLADWEELR

HMMPanther: PTHR23155
37-270 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEDRESASHVLHEWLDCLKDAVYDIDDLLDDASTEALMLHVHKGLSRIESMSLLVTGPFKLSHKIEQVRKKLDEIAKDRGQFGLNEQPIIDRRMFRSSNRETHSFITESDIIGRAEAKNKIIEKILTAKDSKPLSVLPIVGLGGIGKTALAKWIYNDVQVTQNFEMKLWVCVSDVFNLKKILDDIIQSGTGXKQHEAKSRDAAXEVVCTFEGXRYFLVLDDLWNDKLADWEELR

Seg: seg
60-67 seg

DIDDLLDD

superfamily: SSF52540
130-270 P-loop containing nucleoside triphosphate hydrolases

MFRSSNRETHSFITESDIIGRAEAKNKIIEKILTAKDSKPLSVLPIVGLGGIGKTALAKWIYNDVQVTQNFEMKLWVCVSDVFNLKKILDDIIQSGTGXKQHEAKSRDAAXEVVCTFEGXRYFLVLDDLWNDKLADWEELR

HMMPfam: PF00931
IPR002182
153-273 NB-ARC,NBS
NB-ARC

AKNKIIEKILTAKDSKPLSVLPIVGLGGIGKTALAKWIYNDVQVTQNFEMKLWVCVSDVFNLKKILDDIIQSGTGXKQHEAKSRDAAXEVVCTFEGXRYFLVLDDLWNDKLADWEELRGCY

FPrintScan: PR00364
IPR000767
172-187 DISEASERSIST
Disease resistance protein

VLPIVGLGGIGKTALA

FPrintScan: PR00364
IPR000767
245-259 DISEASERSIST
Disease resistance protein

TFEGXRYFLVLDDLW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox