PRGDB00077748 (Ta.37890)

From PRG Wiki
Jump to: navigation, search
Ta.37890
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 22300061 (BQ901277)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Ta02_20d01_R Ta02_AAFC_ECORC_Fusarium_graminearum_inoculated_wheat_heads Triticum aestivum cDNA clone Ta02_20d01, mRNA sequence

DNA Sequence

YACGCAGCCCAGACCCAAYACCCGGCCCACCCCYCCAAGAGCAYYYCCYYYCAYCAYAGCACCCCAAYYYYGCCYYACAYCABCCCAGGYYGACCYYCGCYGAYCACCAAYYAGAAGATTYGCYAYACYATTGATAGCAAGTGGCAAACCACCACAYCYTTTTAGAATATGAATTGAAATATCYTTAAGTGCATCYGGGCAAGGTTCCTTCGGACCAAATATTCTGCTTAAGAATAGTGTTCTTGAGTCATTGTCACTGAGTGGATTCATCATACGAATACATTTCATTTCATCATAGCAACAGGCACGAGCAACATGATCAAYCCYTGTTGTTGTGATCACYCYAATACCATAGTTGTTTCCYGGCAAAGCAAATTTAATAGTATCCCAAGTTTCATTATTCATTGTTTCAGAATCCCATAGATCATCAATTACTATGAAATATCTCTCATACATGAGCAATTGCTGGAGTTGACTGGKGAGCTGCTCCACATCCAAATGTTCCATGTTTGTTGCATCCTTTCCACATCCAGTTAGAATGTTCTTCAAAACTACCTTCACATCAACATTCTGGCCCACCTTGACAAAAGCCATAGGATGGTATTGTGCTTCCAGCTTGTCATACACAGCCTTCACAAGTGTGGTCTTACCCAATCCYCCCATACCGACGATAGAGAATATCTTGAGCTTATTGTTTGGTACT


Protein sequences

Name Description Sequence
Ta.37890 translated coding region predicted by ESTScan from UniGene Ta.37890

XVPNNKLKIFSIVGMGGLGKTTLVKAVYDKLEAQYHPMAFVKVGQNVDVKVVLKNILTGCGKDATNMEHLDVEQLXSQLQQLLMYERYFIVIDDLWDSETMNNETWDTIKFALPGNNYGIXVITTTXXDHVARACCYDEMKCIRMMNPLSDNDSRTLFLSRIFGPKEPCPDALXDISIHILKXCGGLPLAINXXANLLXGXXRXSXWXXVXXXWGAXXXGXALGGVGRVLGLGCV

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.300
4-127 no description

NNKLKIFSIVGMGGLGKTTLVKAVYDKLEAQYHPMAFVKVGQNVDVKVVLKNILTGCGKDATNMEHLDVEQLXSQLQQLLMYERYFIVIDDLWDSETMNNETWDTIKFALPGNNYGIXVITTTX

superfamily: SSF52540
5-200 P-loop containing nucleoside triphosphate hydrolases

NKLKIFSIVGMGGLGKTTLVKAVYDKLEAQYHPMAFVKVGQNVDVKVVLKNILTGCGKDATNMEHLDVEQLXSQLQQLLMYERYFIVIDDLWDSETMNNETWDTIKFALPGNNYGIXVITTTXXDHVARACCYDEMKCIRMMNPLSDNDSRTLFLSRIFGPKEPCPDALXDISIHILKXCGGLPLAINXXANLLXG

HMMPfam: PF00931
IPR002182
5-214 NB-ARC,NBS
NB-ARC

NKLKIFSIVGMGGLGKTTLVKAVYDKLEAQYHPMAFVKVGQNVDVKVVLKNILTGCGKDATNMEHLDVEQLXSQLQQLLMYERYFIVIDDLWDSETMNNETWDTIKFALPGNNYGIXVITTTXXDHVARACCYDEMKCIRMMNPLSDNDSRTLFLSRIFGPKEPCPDALXDISIHILKXCGGLPLAINXXANLLXGXXRXSXWXXVXXXW

HMMPanther: PTHR11017:SF126
9-198 OS11G0237600 PROTEIN,OS11G0237600 PROTEIN

IFSIVGMGGLGKTTLVKAVYDKLEAQYHPMAFVKVGQNVDVKVVLKNILTGCGKDATNMEHLDVEQLXSQLQQLLMYERYFIVIDDLWDSETMNNETWDTIKFALPGNNYGIXVITTTXXDHVARACCYDEMKCIRMMNPLSDNDSRTLFLSRIFGPKEPCPDALXDISIHILKXCGGLPLAINXXANLL

HMMPanther: PTHR11017
9-198 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IFSIVGMGGLGKTTLVKAVYDKLEAQYHPMAFVKVGQNVDVKVVLKNILTGCGKDATNMEHLDVEQLXSQLQQLLMYERYFIVIDDLWDSETMNNETWDTIKFALPGNNYGIXVITTTXXDHVARACCYDEMKCIRMMNPLSDNDSRTLFLSRIFGPKEPCPDALXDISIHILKXCGGLPLAINXXANLL

FPrintScan: PR00364
IPR000767
9-24 DISEASERSIST
Disease resistance protein

IFSIVGMGGLGKTTLV

Seg: seg
41-54 seg

VKVGQNVDVKVVLK

Seg: seg
74-83 seg

QLXSQLQQLL

FPrintScan: PR00364
IPR000767
82-96 DISEASERSIST
Disease resistance protein

LLMYERYFIVIDDLW

Seg: seg
124-128 seg

TTTXX

FPrintScan: PR00364
IPR000767
184-198 DISEASERSIST
Disease resistance protein

CGGLPLAINXXANLL

Seg: seg
186-202 seg

GLPLAINXXANLLXGXX

Seg: seg
206-214 seg

XWXXVXXXW

Seg: seg
215-233 seg

GAXXXGXALGGVGRVLGLG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox