PRGDB00077753 (Ta.38207)

From PRG Wiki
Jump to: navigation, search
Ta.38207
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 32128555 (BT009004)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Triticum aestivum

Comment?

Triticum aestivum clone wdk2c.pk018.c16:fis, full insert mRNA sequence

DNA Sequence

GCACGAGGCGCTCTCGTCGCCTCCCCACCCATTCCAGCGGTTGACCGCGGGATTCGGCCAGTGAAAATGGAAGGGAACACTAGAGGAGGTGGGCATTCTGACGCATTAAAGAACTACAATGTGGGCAGAACATTAGGTATAGGCACATTTGGAAAAGTGAGGATTGCAGAGCATAAGCATACAGGGCATAAAGTTGCTATAAAGATTCTGAACCGTCGTCAAATGAGAACTATGGAAATGGAGGAGAAAGCAAAGAGAGAGATCAAGATATTGAGGTTGTTCATCCACCCTCATATCATCCGGCTTTATGAGGTCATTTACACACCTACAGATATATTTGTTGTGATGGAATATTGCAAGTATGGTGAGCTATTCGACTGCATTGTTGAGAAAGGGCGGTTACAGGAAGATGAGGCTCGTCGAATCTTCCAGCAGATTATATCTGGTGTTGAATACTGCCACAGAAACATGGTTGCTCATCGTGATCTAAAGCCAGAGAACCTGTTACTTGATTCCAAATACAATGTGAAACTTGCCGACTTTGGGTTAAGTAATGTCATGCATGATGGCCATTTTCTGAAGACTAGCTGCGGGAGTCCAAACTATGCTGCACCAGAGGTTATCTCAGGTAAATTATACGCTGGACCTGAGGTTGATGTTTGGAGCTGCGGGGTGATACTTTATGCTCTTCTTTGTGGCACTCTTCCATTTGATGATGACAATATTCCCAAACTGTTCAAAAAGATAAAGGGAGGCATCTATATCCTTCCAAGTCATTTATCTGCTCTTGCAAGGGATTTGATCCCAAGAATGCTTGTTGTTGATCCTATGAAGAGAATCACAATTCGTGAAATTCGAGAACACCCATGGTTTCAGAATCGCCTTCCTCGCTACCTGGCAGTGCCTCCACCAGACACGGCGCAGCAAGCCAAAATGATTGATGAAGATACACTTAAAGAGATTGTCAACCTGGGATATGATAAAGACCATGTGTGTGAATCATTGTGCAATAGGCTGCAAAATGAGGCAACTGTTGCATATTACTTACTCTTGGACAATCGGTTCCGGGCCACTAGTGGCTATTTGGGGGCTGACTATCTACAATCAATGGGTAGGAGTTTTAATCAGTTTACTTCATTGGAATCAGCAAGCCCAAGTACCAGGCAGTATCTTCCAGCAAGCAATGATTCTCAAGGCAGTGGCTTGCGGCCATATTACCCCGTTGAAAGAAAATGGGCTCTTGGGCTCCAGTCTCGAGCTCAACCTCGTGAGATAATGATCGAGGTTCTAAAGGCACTTCAAGAATTAAATGTCTGCTGGAAGAAGAATGGACACTACAACATGAAATGCAGGTGGTGCCCTGGGTTTCCTCAGGTCAGTGATATGTTAGATGCCAACCACAGCTTTGTTGATGACTCTACCATCATGGATAACGGCGATGCTAATGGGAGGCTACCTGCCGTGATCAAGTTTGAAATCCAGCTTTACAAGACCAAGGATGACAAGTACCTGCTAGATATGCAGAGAGTTACTGGACCTCAGCTCCTCTTCCTGGATTTTTGCGCGGCCTTCCTTACCAACCTTAGGGTTCTATAGTATGGTGCCTGTTCTGGTTGAGTGATGAATAGTGAGACATATGACCGTCAGCGATGAATAAGTTGGTGCCTGTTCTGGTTGAGTGATGAATAGTGAGACATGTGACTGTCAGAGATGAATAAGTGATGGTGTGTAAATAGGTGGTGTGTTTCATCTTCGTTTTACCCAGTCCCTGACAGCGAACCGTGTTGTTTGGGTGACTAGTCCTGTGTGAAGCACCAAAAGTGTTGTTTGGGTGaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ta.38207 translated coding region predicted by ESTScan from UniGene Ta.38207

ARGALVASPPIPAVDRGIRPVKMEGNTRGGGHSDALKNYNVGRTLGIGTFGKVRIAEHKHTGHKVAIKILNRRQMRTMEMEEKAKREIKILRLFIHPHIIRLYEVIYTPTDIFVVMEYCKYGELFDCIVEKGRLQEDEARRIFQQIISGVEYCHRNMVAHRDLKPENLLLDSKYNVKLADFGLSNVMHDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDDNIPKLFKKIKGGIYILPSHLSALARDLIPRMLVVDPMKRITIREIREHPWFQNRLPRYLAVPPPDTAQQAKMIDEDTLKEIVNLGYDKDHVCESLCNRLQNEATVAYYLLLDNRFRATSGYLGADYLQSMGRSFNQFTSLESASPSTRQYLPASNDSQGSGLRPYYPVERKWALGLQSRAQPREIMIEVLKALQELNVCWKKNGHYNMKCRWCPGFPQVSDMLDANHSFVDDSTIMDNGDANGRLPAVIKFEIQLYKTKDDKYLLDMQRVTGPQLLFLDFCAAFLTNLRVL

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
25-322 Protein kinase-like (PK-like)
Protein kinase-like domain

GNTRGGGHSDALKNYNVGRTLGIGTFGKVRIAEHKHTGHKVAIKILNRRQMRTMEMEEKAKREIKILRLFIHPHIIRLYEVIYTPTDIFVVMEYCKYGELFDCIVEKGRLQEDEARRIFQQIISGVEYCHRNMVAHRDLKPENLLLDSKYNVKLADFGLSNVMHDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDDNIPKLFKKIKGGIYILPSHLSALARDLIPRMLVVDPMKRITIREIREHPWFQNRLPRYLAVPPPDTAQQAKMIDEDTLKEIV

Gene3D: G3DSA:3.30.200.20
32-136 no description

HSDALKNYNVGRTLGIGTFGKVRIAEHKHTGHKVAIKILNRRQMRTMEMEEKAKREIKILRLFIHPHIIRLYEVIYTPTDIFVVMEYCKYGELFDCIVEKGRLQE

HMMPanther: PTHR24343:SF123
32-356 SUBFAMILY NOT NAMED

HSDALKNYNVGRTLGIGTFGKVRIAEHKHTGHKVAIKILNRRQMRTMEMEEKAKREIKILRLFIHPHIIRLYEVIYTPTDIFVVMEYCKYGELFDCIVEKGRLQEDEARRIFQQIISGVEYCHRNMVAHRDLKPENLLLDSKYNVKLADFGLSNVMHDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDDNIPKLFKKIKGGIYILPSHLSALARDLIPRMLVVDPMKRITIREIREHPWFQNRLPRYLAVPPPDTAQQAKMIDEDTLKEIVNLGYDKDHVCESLCNRLQNEATVAYYLLLDNRFR

HMMPanther: PTHR24343
32-356 FAMILY NOT NAMED,SERINE/THREONINE KINASE

HSDALKNYNVGRTLGIGTFGKVRIAEHKHTGHKVAIKILNRRQMRTMEMEEKAKREIKILRLFIHPHIIRLYEVIYTPTDIFVVMEYCKYGELFDCIVEKGRLQEDEARRIFQQIISGVEYCHRNMVAHRDLKPENLLLDSKYNVKLADFGLSNVMHDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDDNIPKLFKKIKGGIYILPSHLSALARDLIPRMLVVDPMKRITIREIREHPWFQNRLPRYLAVPPPDTAQQAKMIDEDTLKEIVNLGYDKDHVCESLCNRLQNEATVAYYLLLDNRFR

ProfileScan: PS50011
IPR000719
39-291 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YNVGRTLGIGTFGKVRIAEHKHTGHKVAIKILNRRQMRTMEMEEKAKREIKILRLFIHPHIIRLYEVIYTPTDIFVVMEYCKYGELFDCIVEKGRLQEDEARRIFQQIISGVEYCHRNMVAHRDLKPENLLLDSKYNVKLADFGLSNVMHDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDDNIPKLFKKIKGGIYILPSHLSALARDLIPRMLVVDPMKRITIREIREHPWF

HMMPfam: PF00069
IPR017442
39-291 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YNVGRTLGIGTFGKVRIAEHKHTGHKVAIKILNRRQMRTMEMEEKAKREIKILRLFIHPHIIRLYEVIYTPTDIFVVMEYCKYGELFDCIVEKGRLQEDEARRIFQQIISGVEYCHRNMVAHRDLKPENLLLDSKYNVKLADFGLSNVMHDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDDNIPKLFKKIKGGIYILPSHLSALARDLIPRMLVVDPMKRITIREIREHPWF

HMMSmart: SM00220
IPR002290
39-291 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YNVGRTLGIGTFGKVRIAEHKHTGHKVAIKILNRRQMRTMEMEEKAKREIKILRLFIHPHIIRLYEVIYTPTDIFVVMEYCKYGELFDCIVEKGRLQEDEARRIFQQIISGVEYCHRNMVAHRDLKPENLLLDSKYNVKLADFGLSNVMHDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDDNIPKLFKKIKGGIYILPSHLSALARDLIPRMLVVDPMKRITIREIREHPWF

HMMSmart: SM00219
IPR020635
39-291 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YNVGRTLGIGTFGKVRIAEHKHTGHKVAIKILNRRQMRTMEMEEKAKREIKILRLFIHPHIIRLYEVIYTPTDIFVVMEYCKYGELFDCIVEKGRLQEDEARRIFQQIISGVEYCHRNMVAHRDLKPENLLLDSKYNVKLADFGLSNVMHDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDDNIPKLFKKIKGGIYILPSHLSALARDLIPRMLVVDPMKRITIREIREHPWF

PatternScan: PS00107
IPR017441
45-68 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGIGTFGKVRIAEHKHTGHKVAIK

Gene3D: G3DSA:1.10.510.10
137-311 no description

DEARRIFQQIISGVEYCHRNMVAHRDLKPENLLLDSKYNVKLADFGLSNVMHDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDDNIPKLFKKIKGGIYILPSHLSALARDLIPRMLVVDPMKRITIREIREHPWFQNRLPRYLAVPPPDTAQQAK

PatternScan: PS00108
IPR008271
158-170 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VAHRDLKPENLLL

ProfileScan: PS50030
IPR015940
312-352 UBA
Ubiquitin-associated/translation elongation factor

MIDEDTLKEIVNLGYDKDHVCESLCNRLQNEATVAYYLLLD

Gene3D: G3DSA:1.10.8.10
313-350 no description

IDEDTLKEIVNLGYDKDHVCESLCNRLQNEATVAYYLL

superfamily: SSF103243
IPR001772
402-530 Kinase associated domain 1, KA1
Kinase-associated KA1

LRPYYPVERKWALGLQSRAQPREIMIEVLKALQELNVCWKKNGHYNMKCRWCPGFPQVSDMLDANHSFVDDSTIMDNGDANGRLPAVIKFEIQLYKTKDDKYLLDMQRVTGPQLLFLDFCAAFLTNLRV

ProfileScan: PS50032
IPR001772
482-530 KA1
Kinase-associated KA1

NGRLPAVIKFEIQLYKTKDDKYLLDMQRVTGPQLLFLDFCAAFLTNLRV

HMMPfam: PF02149
IPR001772
486-530 KA1
Kinase-associated KA1

PAVIKFEIQLYKTKDDKYLLDMQRVTGPQLLFLDFCAAFLTNLRV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox