PRGDB00077762 (Ta.38868)

From PRG Wiki
Jump to: navigation, search
Ta.38868
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241987293 (AK334550)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: WT010_E10, cultivar: Chinese Spring

DNA Sequence

GGCGCGGCCCAAAACTGCCGCCGCCTGCTCAACTCCGGCCGGTGCAATTTCACCGACGGGGAACCGTTTGCCGCATCCACTGGAGATGCTCTGACAACAGATGCACAACTCGTCTGCTAGGGCGAGAGAGAGGGGCTCGCATGTAGACTAGCTAGCTAGGGGTACATCGGGATGGAGGTTGCGGTGGTCGTCGGCCCGATAGTGAAGCTCCTGCCGAAGCTCCTATCGGTGGTAGATGGGAAACGGAAGCAGCTGGACAACCTGGAGGTGGACGCCGGGTTCATCCGGCGCGACCTGCAGTCGATCCAAGAAATCATTGGCCGCTCCAGTGGCGGCAGATCCATCACGGACCTCTGGGTCCGAGATCTCAGGCGCCTGGCGGACGACATGGAAGACTGCATCGACCGATTCCAGGTCGGGAAGATGAGCAGAATCCGTTTCGTCGGAAAGATCGGCAAACTGAAGAAGCGGTCAAAGGAGACTCTCGAGCAGCTACAGAACTGCATCAGCATCGCTGGCGCCGCCGCACCTGATCCCCCCGCTGCAGGTGGGGGCACCGAGGATCCGGAGGAGCAGCTACTTGCTCTGCTTGCGCGGAGCCCATCGGAGGGAAACCTCAAGGTGATCTCCGTCGCCGGCTTCGGTGGAGCAGGTATGACTCGCCTTGCCCACAAGGTGTACAGCAACAGGGATGTGCTCAGCCAGTTCCCTCTGCACGCTTGGGTTCGTGCAGCGCCCGGCATGAGTGTGCACAAGCTTCTTCAGAAAATACATGACCAGCTGCTGCTAATTAGTATGGCCAAGAATCATGGTGCCACTGCCTCCAGCTCCAAAATCAAACCACAAGCCAACGGAGACGACGCCGAACATGCTTCGACTGACCACCGGCTCACCGGATTACTCAAGACCGGAAGGTATTTGATTGTGATTGATGGCGTGAATACGCATGACTTGTACGACGTGCTATCTGCCTTCTCTTGGGCTGATGGAGTGGATGGCAGAATTATCATGACGGCGGCAATTCAGCTGCCAGAAGCAACATGCTGCAGATGTGGCAACGGTTCACCACTCGCCATGGATAGCACAAGCCAGGTTTTCATTGGAGAGCTGACAGAGACTGGATTTGTGGAGGCCTGCCTCCATCTTCGTGACGACACACTAGCAAGAATGCAACGCAGCAACAACGAGATCCTATCAAGTCCCATTGTCCAGGACTTATTGCTGTATTTCTGCATGTTCCCACGCGATCATCCTGTCAGGAGGAATCCCCTGATAAGGCGATGGCTGGCTGAAGGACTTGTGTTTCCTCAACCAGAAACAGAGAGTTTTTCGCAGGATGTTGCAGCCAAGAATTTGGAGAGCCTCATCACCCGCAATGTCATTCAGCCCATTCAAGTGAGGAACTATGGAAATGTGAAGAGATGCCAAACTTTTGGGATGATGCTTAACTCCATTTCCAGCAAATCCAAGTCACAGAACTTCATCACCATGCTGTGTGGTAGCGGCCAGACGACGGAGAGGAGTCCGGCTGGCAAGGAGATTCGCCGGCTTTCCCTCCATCTTAACGGTGCGGCAAATGGGCCACTGAATTTGCCAAAGGAATTATCTCGTCTCCATACTTTGGCAGTATTCCCTGATGATGCAAATGTCGCCAGGCATCAGGCTAATTTGAATTATGCCAAGTATAAGCTACTCCGAGTTTTGGATCTCAAAGAATGTGCTGATGTGAAAGCAGAACATGTCGGGAAAATATGTGACCTGTTGCTGCTCAAATATCTGAGCCTCGGGGACAGTATTGACAAGGTTCCGAGGAAAATAGCGAAGCTAAAATGGTTAGAGACTCTCGACATGAGGAGAACCCAGGTAGTGACGCTACCAATTGAAGTCCTCCAGCTCCCTGGGTTGAAACACCTCCTTGGGAAGTTTCAGCTAGCTGAAGGTGACTGCACACAGAAGAAGCTAGAGAGGCTCATGTCAAAAGATAGTGAACTTCAGAGGCTTTCCGGATTTGTCACCGACAAAAGCGAAGGGTTTGCGCAGCTGATGAGTCGCATGGGGAAGTTGAGGAAGGTGAAAATATGGTGCGATTCCACCGCAGATGTGACGAAACTGGTTCATGTTTTAGGAGCCACAAAGAAATTCATTGGTGGAGGCCTGGATATGACAAGAGTCGATCGTTCTTTGTCTATCGACTTCCAAGGATGCCCAACGGAATGCTCAGAACAATTCATGGATTCTCTGAAAGCTACAGGCCGTCTTACCTCACTCAAATTGCGAGGCAAGCTGACGCAACTCCCTCAGTTCCGTGCAAAGCTGAACTACATCGAGGAGTTGTGCCTCTCAAGGACTAATCTGAGCGGTGACACAATCCTAAGTAGCCTGTCTGGACTGAAAATGACACTGAAATATCTCAAGCTGGTAGAAGACAGGCTTGGTCACTTGGTCATAAAACCAGAGCATTTCCGAAGCTTGAAGGGGTTATGCCTCGTGGGCGAGCAAAGTGGAGGGCATAACAATCCAAGATGAAGCTATGCCCTACCTTGTGTCACTTCATATACTTTGTGAAGCTCTAGGTGATCTTCCAGGAATCGACATCACACGCATGGCAAGGCTAAAAGAAGTCGCGCTCCATTCTGGAGTACAAGATACGATAAAGGATGGGTGGCAAGCAGCTGCAATGAACCATCCTAATAGGCCCAACGTTTTGTTTATCCATCATGCTAACTCGTCGCCTAGAGACTCTCCGCCGTGTGAAGCAACAGGGGATATTGTAAATCGGACCAAACCTGTTGGGAGAAAATTCGCCGCCTCCATCATGGGGGGCATCTTTTCTCGTGCACGGCCAAGATCCTGATGCACTGAAGCAAGTCGCATCGATCATGAGCAAAACTTTTTCCAACCATTCGCCGATTGATGATGTGTGTGCTGCATATACCTGGCCATGGGaagcccggcccggccggcccggcccgaaaaagcctgacccggcccggcccgacgctgcccccGGGCCGGGCTCGGGCCTAGATTTTGAGCCCGAAGGTCGGGCCGGGCCGGGTCCGGGCCGTCATTTGTGCGCTTTCCTGAAGGTCGGGCCGGGCCGGCCCGAAGCCCGACGGGCTTTTAGGTGTTCGGGCCGGGCTCGGGCCCAAAAAACAGGCCCGTTGGTTGGGCCGGGCCGGGCCTGGGCCTGGGTTTTTTGCGTCGGGCTTGGCTAGGCCCAGCCCGGCCCGAGGTATGGCCAGGTATAGTGCTGCACGATGCGGCCTTCGGGAGGTGTGACTTCTCCTTTGCGAGGTGGCTGCTGGTGGTGAGTAGAGTGAGATGATGCATCCTCTTCGTGATGATTGATGATGTCATGATAAGAAATTTACGAGTGAATTCCGCCGATAACGTTTCATGGCAAGAACGGAGCCAGCCATACAGGTACATTGTGTAGAGATGTTGCTGATTAGAGAGTTTGTTAATTTGATTCGATAATGAGTTTATACAATGGAACAGCCACACTTCTCTATTTTGCAAATGCATCGAATAAAGGAAGTTCAGGTaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.38868 translated coding region predicted by ESTScan from UniGene Ta.38868

GAAQNCRRLLNSGRCNFTDGEPFAASTGDALTTDAQLVCXGEREGLACRLASXGYIGMEVAVVVGPIVKLLPKLLSVVDGKRKQLDNLEVDAGFIRRDLQSIQEIIGRSSGGRSITDLWVRDLRRLADDMEDCIDRFQVGKMSRIRFVGKIGKLKKRSKETLEQLQNCISIAGAAAPDPPAAGGGTEDPEEQLLALLARSPSEGNLKVISVAGFGGAGMTRLAHKVYSNRDVLSQFPLHAWVRAAPGMSVHKLLQKIHDQLLLISMAKNHGATASSSKIKPQANGDDAEHASTDHRLTGLLKTGRYLIVIDGVNTHDLYDVLSAFSWADGVDGRIIMTAAIQLPEATCCRCGNGSPLAMDSTSQVFIGELTETGFVEACLHLRDDTLARMQRSNNEILSSPIVQDLLLYFCMFPRDHPVRRNPLIRRWLAEGLVFPQPETESFSQDVAAKNLESLITRNVIQPIQVRNYGNVKRCQTFGMMLNSISSKSKSQNFITMLCGSGQTTERSPAGKEIRRLSLHLNGAANGPLNLPKELSRLHTLAVFPDDANVARHQANLNYAKYKLLRVLDLKECADVKAEHVGKICDLLLLKYLSLGDSIDKVPRKIAKLKWLETLDMRRTQVVTLPIEVLQLPGLKHLLGKFQLAEGDCTQKKLERLMSKDSELQRLSGFVTDKSEGFAQLMSRMGKLRKVKIWCDSTADVTKLVHVLGATKKFIGGGLDMTRVDRSLSIDFQGCPTECSEQFMDSLKATGRLTSLKLRGKLTQLPQFRAKLNYIEELCLSRTNLSGDTILSSLSGLKMTLKYLKLVEDRLGHLVIKPEHFRSLKGYASWASKVEGITIQDEAMPYLVSLHILCEALGDLPGIDITRMARLKEVALHSGVQDTIKDGWQAAAMNHPNRPNVLFIHHANSSPRDSPPCEATGDIVNRTKPVGRKSPPPSWGASFLVHGQDPDALKQVASIMSKTFSNHSPIDDVCAAYTWPWEARPGRPGPKKPDPARPDAAPGPGSGLDFEPEGRAGPGPGRHLCAFLKVGRAGPKPDGLLGVRAGLGPKKQARWLGRAGPGPGFFASGLARPSPARGMARYSAARCGLREV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF268
56-926 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IGMEVAVVVGPIVKLLPKLLSVVDGKRKQLDNLEVDAGFIRRDLQSIQEIIGRSSGGRSITDLWVRDLRRLADDMEDCIDRFQVGKMSRIRFVGKIGKLKKRSKETLEQLQNCISIAGAAAPDPPAAGGGTEDPEEQLLALLARSPSEGNLKVISVAGFGGAGMTRLAHKVYSNRDVLSQFPLHAWVRAAPGMSVHKLLQKIHDQLLLISMAKNHGATASSSKIKPQANGDDAEHASTDHRLTGLLKTGRYLIVIDGVNTHDLYDVLSAFSWADGVDGRIIMTAAIQLPEATCCRCGNGSPLAMDSTSQVFIGELTETGFVEACLHLRDDTLARMQRSNNEILSSPIVQDLLLYFCMFPRDHPVRRNPLIRRWLAEGLVFPQPETESFSQDVAAKNLESLITRNVIQPIQVRNYGNVKRCQTFGMMLNSISSKSKSQNFITMLCGSGQTTERSPAGKEIRRLSLHLNGAANGPLNLPKELSRLHTLAVFPDDANVARHQANLNYAKYKLLRVLDLKECADVKAEHVGKICDLLLLKYLSLGDSIDKVPRKIAKLKWLETLDMRRTQVVTLPIEVLQLPGLKHLLGKFQLAEGDCTQKKLERLMSKDSELQRLSGFVTDKSEGFAQLMSRMGKLRKVKIWCDSTADVTKLVHVLGATKKFIGGGLDMTRVDRSLSIDFQGCPTECSEQFMDSLKATGRLTSLKLRGKLTQLPQFRAKLNYIEELCLSRTNLSGDTILSSLSGLKMTLKYLKLVEDRLGHLVIKPEHFRSLKGYASWASKVEGITIQDEAMPYLVSLHILCEALGDLPGIDITRMARLKEVALHSGVQDTIKDGWQAAAMNHPNRPNVLFIHHANSSPRDSPPCEATGDIVNR

HMMPanther: PTHR23155
56-926 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IGMEVAVVVGPIVKLLPKLLSVVDGKRKQLDNLEVDAGFIRRDLQSIQEIIGRSSGGRSITDLWVRDLRRLADDMEDCIDRFQVGKMSRIRFVGKIGKLKKRSKETLEQLQNCISIAGAAAPDPPAAGGGTEDPEEQLLALLARSPSEGNLKVISVAGFGGAGMTRLAHKVYSNRDVLSQFPLHAWVRAAPGMSVHKLLQKIHDQLLLISMAKNHGATASSSKIKPQANGDDAEHASTDHRLTGLLKTGRYLIVIDGVNTHDLYDVLSAFSWADGVDGRIIMTAAIQLPEATCCRCGNGSPLAMDSTSQVFIGELTETGFVEACLHLRDDTLARMQRSNNEILSSPIVQDLLLYFCMFPRDHPVRRNPLIRRWLAEGLVFPQPETESFSQDVAAKNLESLITRNVIQPIQVRNYGNVKRCQTFGMMLNSISSKSKSQNFITMLCGSGQTTERSPAGKEIRRLSLHLNGAANGPLNLPKELSRLHTLAVFPDDANVARHQANLNYAKYKLLRVLDLKECADVKAEHVGKICDLLLLKYLSLGDSIDKVPRKIAKLKWLETLDMRRTQVVTLPIEVLQLPGLKHLLGKFQLAEGDCTQKKLERLMSKDSELQRLSGFVTDKSEGFAQLMSRMGKLRKVKIWCDSTADVTKLVHVLGATKKFIGGGLDMTRVDRSLSIDFQGCPTECSEQFMDSLKATGRLTSLKLRGKLTQLPQFRAKLNYIEELCLSRTNLSGDTILSSLSGLKMTLKYLKLVEDRLGHLVIKPEHFRSLKGYASWASKVEGITIQDEAMPYLVSLHILCEALGDLPGIDITRMARLKEVALHSGVQDTIKDGWQAAAMNHPNRPNVLFIHHANSSPRDSPPCEATGDIVNR

Seg: seg
172-185 seg

AGAAAPDPPAAGGG

HMMPfam: PF00931
IPR002182
195-338 NB-ARC,NBS
NB-ARC

ALLARSPSEGNLKVISVAGFGGAGMTRLAHKVYSNRDVLSQFPLHAWVRAAPGMSVHKLLQKIHDQLLLISMAKNHGATASSSKIKPQANGDDAEHASTDHRLTGLLKTGRYLIVIDGVNTHDLYDVLSAFSWADGVDGRIIMT

FPrintScan: PR00364
IPR000767
208-223 DISEASERSIST
Disease resistance protein

VISVAGFGGAGMTRLA

FPrintScan: PR00364
IPR000767
300-314 DISEASERSIST
Disease resistance protein

LLKTGRYLIVIDGVN

superfamily: SSF52058
460-878 L domain-like,LRR

VIQPIQVRNYGNVKRCQTFGMMLNSISSKSKSQNFITMLCGSGQTTERSPAGKEIRRLSLHLNGAANGPLNLPKELSRLHTLAVFPDDANVARHQANLNYAKYKLLRVLDLKECADVKAEHVGKICDLLLLKYLSLGDSIDKVPRKIAKLKWLETLDMRRTQVVTLPIEVLQLPGLKHLLGKFQLAEGDCTQKKLERLMSKDSELQRLSGFVTDKSEGFAQLMSRMGKLRKVKIWCDSTADVTKLVHVLGATKKFIGGGLDMTRVDRSLSIDFQGCPTECSEQFMDSLKATGRLTSLKLRGKLTQLPQFRAKLNYIEELCLSRTNLSGDTILSSLSGLKMTLKYLKLVEDRLGHLVIKPEHFRSLKGYASWASKVEGITIQDEAMPYLVSLHILCEALGDLPGIDITRMARLKEVALHS

FPrintScan: PR00364
IPR000767
560-576 DISEASERSIST
Disease resistance protein

AKYKLLRVLDLKECADV

Seg: seg
587-595 seg

LLLLKYLSL

Gene3D: G3DSA:3.80.10.10
735-872 no description

CPTECSEQFMDSLKATGRLTSLKLRGKLTQLPQFRAKLNYIEELCLSRTNLSGDTILSSLSGLKMTLKYLKLVEDRLGHLVIKPEHFRSLKGYASWASKVEGITIQDEAMPYLVSLHILCEALGDLPGIDITRMARLK

Seg: seg
983-1005 seg

ARPGRPGPKKPDPARPDAAPGPG

Seg: seg
1011-1022 seg

EPEGRAGPGPGR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox