PRGDB00077793 (Ta.41344)

From PRG Wiki
Jump to: navigation, search
Ta.41344
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 70959148 (DR732500)
Gene Class Unknown
Domain Type
Gene Species Triticum aestivum

Comment?

FGAS078420 Triticum aestivum FGAS: TaLt5 Triticum aestivum cDNA, mRNA sequence

DNA Sequence

GCGGCGGTTCTNGCCCAGACTGCNTCCGCTGTGTCCCACCTATTCGTGGAATGCTATAGAATGCTCAAGCTATGCATCCAACGCGCCGGGAGCTCACCGTTTATTgtcgacctgcaggcggccgcagtagtgattTCCAGCGGCGGCCCGGGCAGGTGGGCGCGGGCAGAAGAAGCTGCAAAAGCTGCAAACCTCGTGATGAAGAAGGAAGTAACAGGACTGACATTAAAATGGACTGTTGGATCGGATAACGTTGTTGATGAACCTAGCAGTCGGGATGATGCGAAAGTGCTCGAGGAACTTGTGTCTCATGATGGGCTGCATGCTATAAGGATACACACCTATGGAGGCACCACCTTTCCAACATGGACAGCTATGTTGCAAAACATTGTTGTGATCCATATTTCTCATTGTAAGAAACTGCAATGGTTCTTTAGTGGTGACATTAACACATCCTTTGCATTTTCCAAATCTGAAGGAGCTTACGTTGCAAGAGCTTGTCTGCTTTGAGAGATGGTGGGAAATAGATTATGGAACGCANGGAGAAGTGGTGATGTTTCCTCGGCTTGAGAAGTTGCCCTTTAGTCAGTGTGAAAAGTTGACAGCATTGCCAGGGCAAACCGACTTTCCCAACTCCAGATCACTCGTATTGAGAGATGTCCAGAGTTGACGACTAAAGTTGAATCACCAAAGCTCAGGGTATAAAGGATGGAAGGACATGATGTTCAGGTTGTTCAAGGGGGTCCCCGGGCTTTTACTTTATTGGACAATTTTAAACGGGTTACCCTTTGTGAAACGTCaaaaaaaaaCCCCCCGGGGGCTTAAGATATGTTTGGGGGATTTTCGGGTTCGCGGGTGCANGGAATTTCCTTATTTCCCCTCAAACTTTTGGGGCT


Protein sequences

Name Description Sequence
Ta.41344 translated coding region predicted by ESTScan from UniGene Ta.41344

AAVLAQTASAVSHLFVECYRMLKLCIQRAGSSPFIVDLQAAAVVISSGGPGRWARAEEAAKAANLVMKKEVTGLTLKWTVGSDNVVDEPSSRDDAKVLEELVSHDGLHAIRIHTYGGTTFPTWTAMLQNIVVIHISHCKKLQWFFSGDINTSFAFSKSEGAYVEELVCFERWWEIDYGTXGEVVMFPRLEKLPFSQCEKLTALPGQTDFPNSRSLVLRDVQS

Domains

Domain Start-End Description Sequence

Seg: seg
54-63 seg

ARAEEAAKAA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox