PRGDB00077797 (Ta.41454)

From PRG Wiki
Jump to: navigation, search
Ta.41454
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 70958598 (DR732219)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Triticum aestivum

Comment?

FGAS078139 Triticum aestivum FGAS: TaLt5 Triticum aestivum cDNA, mRNA sequence

DNA Sequence

cccagctattaggtgacactatagaatactcaagctatgcatccaacgcgttgggagctctcccatatggtcgacctgcaggcggccgcactagtgattagcgtggtcgcggccgaggtaGTGTATCAACGCAGAGCCCACGGACCTGCCGTTGTCACTTCTCAAAGGCATCACAAATGGCTTCTCTCCTGCTCACCAAATTGGCAGGGGCGGGTTTGCCGAGGTTTACAAGGGAGTGGTCGGGAAACGTATGGTCGCCGTGAAGAGGCTGTCAAGGACGTTTGCTCTTCACGAGAATAAATTCCAGGAAGAGGTCAAATGCCTAATAAAGGCCAAGCACAAGAATATTGTCCGGTTTCTGGGGTATTGCGCTGACACGCAGGGTAAAATGGAAGAGTACGAGGGGAATCTTGTCATGGCAGATCAACGCAACTGGTTGCTCTGCTTTGAGTATGTATGCAATGGGAGTCTCGATAAGCACATTACTGCTGCAACTTGTGGACTTAATTGGAGGGAGCGCTATCAAATAATCAGGGGGATATGTGAGGGTTTACTTTTTCTGCACAAGAAGAGAATTCTTCACTCGGACCTGAAGCCTGCTAATATATTGCTAGATGGTCACATGGTACCCAAAATTGCCGATTTTGGTCTGTCGAGGTGCCTCGGTGAAGAGCAAACCCGTTATCTTACTCAAAACCTATGGGGAACACTGGGATACGTGGATCCAGAATACATCAGATCAAGACAAATCTCATTCTCGTCAGACATGTATAGTCTTGGCGTTATAATAATGGAGATAGTGGCAGGAATTAGGTGCTATCGCGAAGATGAGGATGTAAGCATAATCTAGGCGTTTGCTCCAAGTTGAATTGGTGATTTTAAATACCATTCTTATTTATTTTTGAGATTTCT


Protein sequences

Name Description Sequence
Ta.41454 translated coding region predicted by ESTScan from UniGene Ta.41454

XQLLGDTIEYSSYASNALGALPYGRPAGGRTSDXRGRGRGSXINAEPTDLPLSLLKGITNGFSPAHQIGRGGFAEVYKGVVGKRMVAVKRLSRTFALHENKFQEEVKCLIKAKHKNIVRFLGYCADTQGKMEEYEGNLVMADQRNWLLCFEYVCNGSLDKHITAATCGLNWRERYQIIRGICEGLLFLHKKRILHSDLKPANILLDGHMVPKIADFGLSRCLGEEQTRYLTQNLWGTLGYVDPEYIRSRQISFSSDMYSLGVIIMEIVAGIRCYREDEDVSII

Domains

Domain Start-End Description Sequence

Seg: seg
28-42 seg

GGRTSDXRGRGRGSX

superfamily: SSF56112
IPR011009
34-283 Protein kinase-like (PK-like)
Protein kinase-like domain

XRGRGRGSXINAEPTDLPLSLLKGITNGFSPAHQIGRGGFAEVYKGVVGKRMVAVKRLSRTFALHENKFQEEVKCLIKAKHKNIVRFLGYCADTQGKMEEYEGNLVMADQRNWLLCFEYVCNGSLDKHITAATCGLNWRERYQIIRGICEGLLFLHKKRILHSDLKPANILLDGHMVPKIADFGLSRCLGEEQTRYLTQNLWGTLGYVDPEYIRSRQISFSSDMYSLGVIIMEIVAGIRCYREDEDVSII

Gene3D: G3DSA:3.30.200.20
53-121 no description

SLLKGITNGFSPAHQIGRGGFAEVYKGVVGKRMVAVKRLSRTFALHENKFQEEVKCLIKAKHKNIVRFL

HMMPanther: PTHR24420
55-283 FAMILY NOT NAMED,FAMILY NOT NAMED

LKGITNGFSPAHQIGRGGFAEVYKGVVGKRMVAVKRLSRTFALHENKFQEEVKCLIKAKHKNIVRFLGYCADTQGKMEEYEGNLVMADQRNWLLCFEYVCNGSLDKHITAATCGLNWRERYQIIRGICEGLLFLHKKRILHSDLKPANILLDGHMVPKIADFGLSRCLGEEQTRYLTQNLWGTLGYVDPEYIRSRQISFSSDMYSLGVIIMEIVAGIRCYREDEDVSII

ProfileScan: PS50011
IPR000719
62-283 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSPAHQIGRGGFAEVYKGVVGKRMVAVKRLSRTFALHENKFQEEVKCLIKAKHKNIVRFLGYCADTQGKMEEYEGNLVMADQRNWLLCFEYVCNGSLDKHITAATCGLNWRERYQIIRGICEGLLFLHKKRILHSDLKPANILLDGHMVPKIADFGLSRCLGEEQTRYLTQNLWGTLGYVDPEYIRSRQISFSSDMYSLGVIIMEIVAGIRCYREDEDVSII

HMMSmart: SM00219
IPR020635
62-283 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSPAHQIGRGGFAEVYKGVVGKRMVAVKRLSRTFALHENKFQEEVKCLIKAKHKNIVRFLGYCADTQGKMEEYEGNLVMADQRNWLLCFEYVCNGSLDKHITAATCGLNWRERYQIIRGICEGLLFLHKKRILHSDLKPANILLDGHMVPKIADFGLSRCLGEEQTRYLTQNLWGTLGYVDPEYIRSRQISFSSDMYSLGVIIMEIVAGIRCYREDEDVSII

HMMSmart: SM00220
IPR002290
62-282 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSPAHQIGRGGFAEVYKGVVGKRMVAVKRLSRTFALHENKFQEEVKCLIKAKHKNIVRFLGYCADTQGKMEEYEGNLVMADQRNWLLCFEYVCNGSLDKHITAATCGLNWRERYQIIRGICEGLLFLHKKRILHSDLKPANILLDGHMVPKIADFGLSRCLGEEQTRYLTQNLWGTLGYVDPEYIRSRQISFSSDMYSLGVIIMEIVAGIRCYREDEDVSI

HMMPfam: PF00069
IPR017442
66-277 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

HQIGRGGFAEVYKGVVGKRMVAVKRLSRTFALHENKFQEEVKCLIKAKHKNIVRFLGYCADTQGKMEEYEGNLVMADQRNWLLCFEYVCNGSLDKHITAATCGLNWRERYQIIRGICEGLLFLHKKRILHSDLKPANILLDGHMVPKIADFGLSRCLGEEQTRYLTQNLWGTLGYVDPEYIRSRQISFSSDMYSLGVIIMEIVAGIRCYRED

PatternScan: PS00107
IPR017441
68-89 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGRGGFAEVYKGVVGKRMVAVK

Gene3D: G3DSA:1.10.510.10
122-282 no description

GYCADTQGKMEEYEGNLVMADQRNWLLCFEYVCNGSLDKHITAATCGLNWRERYQIIRGICEGLLFLHKKRILHSDLKPANILLDGHMVPKIADFGLSRCLGEEQTRYLTQNLWGTLGYVDPEYIRSRQISFSSDMYSLGVIIMEIVAGIRCYREDEDVSI

PatternScan: PS00108
IPR008271
193-205 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ILHSDLKPANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox