PRGDB00077808 (Ta.41976)

From PRG Wiki
Jump to: navigation, search
Ta.41976
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 70959919 (DR733115)
Gene Class Unknown
Domain Type LRR
Gene Species Triticum aestivum

Comment?

FGAS077370 Triticum aestivum FGAS: TaLt7 Triticum aestivum cDNA, mRNA sequence

DNA Sequence

atgtttccaacgcgtcccgagctgtcgcnatggtcgacctgcaggcggccgcactagtgattagcgtggtcgcggccgaggtTTTTGATTGAAGATGAATAGATTGAAAGTTTTTCCGaaaaaaaagcaacgaactgtttttttttAGGCAACAACGAACTCGTGTATGATATCTGCTGGCCTCCGCAAAGGGAGAGAAGTAATCCCATCCCAGAGAGAGGGCTTCCAACCCACCCACCCTCTGCTGCTGGTTGATCTGTCGGGCCTCTGCATCCTCTCTGCTCCTTCCTCCCGTCTCCGTAGGCGCAGGCAAATCTCGCTCCCTATCCTACACCTTCGAAGCACAGTCCCAGGCGTGCGCTCTGGCCAGGATGGGGGCGGTTGCCTCAGGCCGCGCCTCGCGCAGCGGCAACCTTCCTCTTCCCCCCTCTGCGCCCTGCCGACGAGGACGGCGGTTGGCCCCCCAGGACGCGCACAACAGCAAGATGGGGGCGGATCGACCATTGTGTCCTTTATGCCGTGGAGTCTTTCAGAGATTCCCACGCGTATGCCGATTTACTACGCAGCTTGGATTTTGTAGACGAGACACGAGAGCAAGTGGAAATACTCCCCACCTTCGCTGCATCGTCTTTTCAACTCCGGGCAGCCTCCTATGCTCAAGCTTTCGAGGGCGGGCAACCGCTCCAGGAGACCATGCGGGAATTCCTCCAAAGCTGGACAACCCATAATACTCAATCGCCTAAGAGAAGTGAGGCCACACATCCCATCCGGCAGCGCTTTCAGGCCACTGCAGAAATTCACTTCGAGACTTCTCAGTTTTGCCAGATCCCCGAGGTTCGAAAGCAGTGCTACCACACTGAGGCAGCCTAAAATCATCAGTGCCTCTAGGGGACACGGGAGGGCCTCCTCCTCAGACGACGAAGTTTCCCCCTCAGGTTGTGACAATACCTGATTTATTGAAGAGCGGGAGGCAACCCAGGACCCGAACCTCCTCTGTTGGCCACGGAACAGATTGCTGCAACTGGTAAATGTCAAAATTTCCAAAAACGAAAGGCATTCCAAACCATAGTTGTGATTTGGGAAACGGAAGCTTCGTACCAGGCTGTTGGGGCCTCCCAAATACAATGCTTCAGTTTTCCAAAAGTATTTAACTTTGGTTGGTGGGGCGTTA


Protein sequences

Name Description Sequence
Ta.41976 translated coding region predicted by ESTScan from UniGene Ta.41976

XNAPPTKVKYFWKTEALYLGGPNSLVRSFRFPNHNYGLECLSFLEILTFTSCSNLFRGQQRRFGSWVASRSSINQVLSQPEGETSSSEEEALPCPLEALMILGCLSVVALLSNLGDLAKLRSLEVNFCSGLKALPDGMCGLTSLRRLSIMGCPALEEFPHGLLERLPALESLSIGGCPELKRRCSEGGEYFHLLSCLVYKIQAAXXIGIRVGISERLHGIKDTMVDPPPSCCCARPGGPTAVLVGRAQRGEEEGCRCARRGLRQPPPSWPERTPGTVLRRCRIGSEICLRLRRREEGAERMQRPDRSTSSRGWVGWKPSLWDGITSLPLRRPADIIHEFVVA

Domains

Domain Start-End Description Sequence

Seg: seg
85-90 seg

SSSEEE

superfamily: SSF52058
96-180 L domain-like,LRR

LEALMILGCLSVVALLSNLGDLAKLRSLEVNFCSGLKALPDGMCGLTSLRRLSIMGCPALEEFPHGLLERLPALESLSIGGCPEL

Gene3D: G3DSA:3.80.10.10
96-182 no description

LEALMILGCLSVVALLSNLGDLAKLRSLEVNFCSGLKALPDGMCGLTSLRRLSIMGCPALEEFPHGLLERLPALESLSIGGCPELKR

HMMPfam: PF13504
142-159 LRR_7,Leucine rich repeat

TSLRRLSIMGCPALEEFP

Seg: seg
249-263 seg

RGEEEGCRCARRGLR

Seg: seg
289-296 seg

LRLRRREE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox