PRGDB00077813 (Ta.42477)

From PRG Wiki
Jump to: navigation, search
Ta.42477
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 241983105 (AK331045)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum cDNA, clone: SET5_O24, cultivar: Chinese Spring

DNA Sequence

GGGTCTTCCCGAGCTCCTACAGGAAAGCCCATccggctccggccatccgccactgctccggccaccgcctcctcctcctcctcgccactgcctcctctccCGTCCAGCAGATCCAGCTGGCGAGCCGAGCTTGGCCTTCTCCACCAAATCCTCGCTGCGGCCCTTGACCTCAACCAGATCCGTGGTGGAGGAGCTGCTCCGGCGGCCTTGGTCGCAGCGGGCACCACGAGCTGGTCGGCCGTGGTGTGGGGATGGCAGTCGTGGTTGGCACTGTGGCCGGCAGCGTAGCCGGTAAGATCGTGCCCAAGCTCTTGGATTTCTTACTGGAGAAGCACAAGCTGCGGGGGGAGCTGGAGAATGAAATCAAGTACATCAAGAGCGAGTCCGCGATGATCTGCGCCGCCATCCGAGAGGACGGCGCTCACCCCCCGTGGAGCGGCGACGAGGTGCACAAGGAATGGATCCAGATGGTGCGCGACCTGGCGTACGCCATCGACGACTGCATCGACCGCTTCATGCACCGGGTGGCGCCGGTGGCCGGCGCGTCGTTCGTCCGCCGGAAGGCCCACAAGATGGAGACGGTGAAGGCCCGTAACGAGTTCGCCTCCGCCATCCGCCGTCTCAGGAAGACGTCGGAGGACGCGTCCGTGCTCCGAACAAAGTACACCACCGGCGTGTACGGACGCGGCGGTGGCGGTGGTGGTGCCTGGGAGTCAGGGCCAGCGGCACCTGAGACAGAGACAGACACCACCGTCTCAGCTGCTGGCCTGCCGGTGCCCGCCGTGGGAATGGACATGTCCCTGGATGAGCTCATGGAGCTGATAGGGGAAACCTCGGCGCAAGGCCAACAACCCAAGGAGCTCAAGGTGATCTCCATTGTAGGATTCGGTGGCATAGGGAAGACTCTGCTTGCCAGGTATGCATACAGCAACCCCGCCGTCGTTGGCCAATACCCAGCAAGGGCTTGGGTTCGTGCTGCCAAGAAAGGCGAAATGGATGTTCTCAATGACATACTCCGGCAACTTGGAATGGATCCCACCACCGTTTGTAGTGGTGATGGAAGTCAAGGCAGCGCCAAACTCTGCGCAACCATAAACGCTTACCTTCAAACCAAGAGGTTCTTCATTGTAATCGATGACATGCAGACAGAGTTTTGGGGAGAAATAAAAGATGCTTTCCCTGTGGTCCCTAGGGAAGACAACAGAGTTATCGTTACGACGGTCAACCGGACCATAGCAAATAAGTGCAGCTCTCCTGCTGGTCATGTCTACTTAATGAGAACTCTTGCTGACAAACCCTCAAGAGAGTTGTTCTTCGAGAAAGCTTGTTTGGTGTGTCCAACACCAACCGGTGATACTGAGCTGGGTTCGGAAGTACTAAAGAAATGTGATGGCCTACCCCTTGCTCTTGTTTCCGCAGCCCAGTTGTTGCACGGTGACCCCACACGGGAACAGTGGGCACATCTGGGTGAAAACCTTGGCAGAGATCTGGCGACAAATGGCAACTTAGCAAGTATGAATCATGCGCTTGTCCGTAGCTACACCAGCTTAAGTAAGCAAGATGTCAAGATCTGCTTACTATATCTGGGAATTTACCCAAGTGGCCGTCCAATCAGGAGGGGAAGCCTTCTAAGGAGATGGTTAGCTGAAAAGTTAATCACAGAAGACCCTACATGCAGTGCCCTCAAGGTCGCTGTTGATAATTTCAATGAGCTGGTCAATAAAAGTATCATCCAGCCTATTACTTGTGCCAACAGCAGCAACAGCGCAGAGGCAAAGACATGCCAAACTCATGGTATGATGCTCGAGTTCATCCGGCACAACACTGAGAATTTTGTCACCTTGTTATACGATAATGCTCCGCTGCCCGGTAATGTCCGCTGGCTTTCTCTGCATAATGAAGTTGCTGTACGGTCCAACATAAATCCCAATGGTTTGCCTCTTCTCCGATCTCTAACAATCTTCGGTGAGGTGCGCAACTGTATGTTGGATTTTTCCAAGTATGAGCTGATGCGAGTTTTGGATCTAGATGAATGTGGTAACCAGTTGGAGGACAAGCACCTCAAGGTGATATGCAGCAACCTGTTGCTACTTAGGTACCTGAGCCTCAGGGGAGCTGCTGCAGTTACAGTTATTCCGAAAGACATCAAGAAGCTTAAGCTTTTGGAGACACTGGATGTAAGAGGAACCAATATAAAGGTTCTACCAACACAAGTCATGAAGTTGCCATGCCTGATTCATCTGTTTGGAAAGTTCATTGTAGAAGACCGGAAAATGGGTAAGCTACAGACTTGGTTGGAAAAGAAGAGTAAATTGCAAACAGTAGCTGGATTTGTTGTAGACGAAAAGAGCCAAGGATTTGCACAGCTTACAGAGCATATGCATCAGTTGACGAAGGTGAAACTATGGTGCACGCGGTCAACTAATAAAAGTACCGATCCCATCGCCACCACTAGCAGCAACTTGAGTCACCTCTCAAAGGCCATTAAGGGGTTCATCATGAGAAGCACCCAGGTGAAAGAAGCTCACTCACTCTCACTGAATTTCAATGATGAATGGTTCCAAGGCTTGCTCGTGGACTTGTCCCTAGAAAAAGAAGCTCCCCCTTGCTACCTGAGCTCGCTCAAGCTACAAGGGGACAACATATGTAGCTTGCCTCCGTTTGTTACCATGCTGCGTGGTCTCACTAAGTTGTGCCTTTCATCCCCAAATCAACAGCTTCAGCTGGGTGAGGAGATTCTTGCTGCCCTGAGCAAAGTGTGTGGCCTGGAATACCTGAAGATCATTGCAACTCAACTAGCTGATCTCATCATCGGACCAGTAACACTTGGAAGCTTGCGGCGCCTATGCATCGTTGTGGAAGCCATGACAGAGCTGGAAATCCAGCAGGGAGCTTTGCCGCGTCTAGAATCGCTTCAGTTGCTATGTAAGAATCTTGATGGCTTTTGCCACGCGGCGGAGATCCAGTCCCTGCCACGTCTCAGTGAGGTTGCTCTCCATAATGGTGTGAACAGTGGAACAAAACAAAAGTGGAAAGAGGCAGCAAAAAGCCACCCCAGGCGTCCCAAGCTCTTGTTTGTTAAGTCGACCGAAGAGGTTGATGTGGAAAGTGAACCTGCGACGCCAACTACTGGTGCGACGTTGCCATTGAAAGGACCACACGGTGCCATTTCTACCAGGCAGTCTGGTAATCAAGGGTTGTGCATTATATTATGCTTAATCGCCACATTGGTTATTGTCATTGGCTGGTTTTCAGAAACGCGGCCTGCAAAAGAAACAGCACCTGGGCTCTCAGTAGCTGTCACTAATGGAAAATAAGGTTTTTCCATCAAAGAAGTGGATGCGGGCGATTGATTCTACATGGGTGTACCAGCTTCTCCTTTCAATTTGTACTTGTACTGCAACATGAGTTTACTTTCATGCATGTCGATTTGGTGGCTTTCTGCTGTAAGGGAGTCACTAGATATGCTGTAAGGATATATATTTGGTCCAAGGTCGATTTTGAAATTCATTTTACAGAACATTATAGTTATATTTCaaaaaaaaaaaaaaaaagaaaaaaaaaaaaaaaCGA


Protein sequences

Name Description Sequence
Ta.42477 translated coding region predicted by ESTScan from UniGene Ta.42477

GSSRAPTGKPIRLRPSATAPATASSSSSPLPPLPSSRSSWRAELGLLHQILAAALDLNQIRGGGAAPAALGRSGHHELVGRGVGMAVVVGTVAGSVAGKIVPKLLDFLLEKHKLRGELENEIKYIKSESAMICAAIREDGAHPPWSGDEVHKEWIQMVRDLAYAIDDCIDRFMHRVAPVAGASFVRRKAHKMETVKARNEFASAIRRLRKTSEDASVLRTKYTTGVYGRGGGGGGAWESGPAAPETETDTTVSAAGLPVPAVGMDMSLDELMELIGETSAQGQQPKELKVISIVGFGGIGKTLLARYAYSNPAVVGQYPARAWVRAAKKGEMDVLNDILRQLGMDPTTVCSGDGSQGSAKLCATINAYLQTKRFFIVIDDMQTEFWGEIKDAFPVVPREDNRVIVTTVNRTIANKCSSPAGHVYLMRTLADKPSRELFFEKACLVCPTPTGDTELGSEVLKKCDGLPLALVSAAQLLHGDPTREQWAHLGENLGRDLATNGNLASMNHALVRSYTSLSKQDVKICLLYLGIYPSGRPIRRGSLLRRWLAEKLITEDPTCSALKVAVDNFNELVNKSIIQPITCANSSNSAEAKTCQTHGMMLEFIRHNTENFVTLLYDNAPLPGNVRWLSLHNEVAVRSNINPNGLPLLRSLTIFGEVRNCMLDFSKYELMRVLDLDECGNQLEDKHLKVICSNLLLLRYLSLRGAAAVTVIPKDIKKLKLLETLDVRGTNIKVLPTQVMKLPCLIHLFGKFIVEDRKMGKLQTWLEKKSKLQTVAGFVVDEKSQGFAQLTEHMHQLTKVKLWCTRSTNKSTDPIATTSSNLSHLSKAIKGFIMRSTQVKEAHSLSLNFNDEWFQGLLVDLSLEKEAPPCYLSSLKLQGDNICSLPPFVTMLRGLTKLCLSSPNQQLQLGEEILAALSKVCGLEYLKIIATQLADLIIGPVTLGSLRRLCIVVEAMTELEIQQGALPRLESLQLLCKNLDGFCHAAEIQSLPRLSEVALHNGVNSGTKQKWKEAAKSHPRRPKLLFVKSTEEVDVESEPATPTTGATLPLKGPHGAISTRQSGNQGLCIILCLIATLVIVIGWFSETRPAKETAPGLSVAVTNGK

Domains

Domain Start-End Description Sequence

Seg: seg
12-39 seg

RLRPSATAPATASSSSSPLPPLPSSRSS

Seg: seg
62-71 seg

GGGAAPAALG

Seg: seg
79-98 seg

VGRGVGMAVVVGTVAGSVAG

HMMPanther: PTHR23155:SF268
93-1052 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

AGSVAGKIVPKLLDFLLEKHKLRGELENEIKYIKSESAMICAAIREDGAHPPWSGDEVHKEWIQMVRDLAYAIDDCIDRFMHRVAPVAGASFVRRKAHKMETVKARNEFASAIRRLRKTSEDASVLRTKYTTGVYGRGGGGGGAWESGPAAPETETDTTVSAAGLPVPAVGMDMSLDELMELIGETSAQGQQPKELKVISIVGFGGIGKTLLARYAYSNPAVVGQYPARAWVRAAKKGEMDVLNDILRQLGMDPTTVCSGDGSQGSAKLCATINAYLQTKRFFIVIDDMQTEFWGEIKDAFPVVPREDNRVIVTTVNRTIANKCSSPAGHVYLMRTLADKPSRELFFEKACLVCPTPTGDTELGSEVLKKCDGLPLALVSAAQLLHGDPTREQWAHLGENLGRDLATNGNLASMNHALVRSYTSLSKQDVKICLLYLGIYPSGRPIRRGSLLRRWLAEKLITEDPTCSALKVAVDNFNELVNKSIIQPITCANSSNSAEAKTCQTHGMMLEFIRHNTENFVTLLYDNAPLPGNVRWLSLHNEVAVRSNINPNGLPLLRSLTIFGEVRNCMLDFSKYELMRVLDLDECGNQLEDKHLKVICSNLLLLRYLSLRGAAAVTVIPKDIKKLKLLETLDVRGTNIKVLPTQVMKLPCLIHLFGKFIVEDRKMGKLQTWLEKKSKLQTVAGFVVDEKSQGFAQLTEHMHQLTKVKLWCTRSTNKSTDPIATTSSNLSHLSKAIKGFIMRSTQVKEAHSLSLNFNDEWFQGLLVDLSLEKEAPPCYLSSLKLQGDNICSLPPFVTMLRGLTKLCLSSPNQQLQLGEEILAALSKVCGLEYLKIIATQLADLIIGPVTLGSLRRLCIVVEAMTELEIQQGALPRLESLQLLCKNLDGFCHAAEIQSLPRLSEVALHNGVNSGTKQKWKEAAKSHPRRPKLLFVKSTEEVDVESEPATPTTGATLPLKG

HMMPanther: PTHR23155
93-1052 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AGSVAGKIVPKLLDFLLEKHKLRGELENEIKYIKSESAMICAAIREDGAHPPWSGDEVHKEWIQMVRDLAYAIDDCIDRFMHRVAPVAGASFVRRKAHKMETVKARNEFASAIRRLRKTSEDASVLRTKYTTGVYGRGGGGGGAWESGPAAPETETDTTVSAAGLPVPAVGMDMSLDELMELIGETSAQGQQPKELKVISIVGFGGIGKTLLARYAYSNPAVVGQYPARAWVRAAKKGEMDVLNDILRQLGMDPTTVCSGDGSQGSAKLCATINAYLQTKRFFIVIDDMQTEFWGEIKDAFPVVPREDNRVIVTTVNRTIANKCSSPAGHVYLMRTLADKPSRELFFEKACLVCPTPTGDTELGSEVLKKCDGLPLALVSAAQLLHGDPTREQWAHLGENLGRDLATNGNLASMNHALVRSYTSLSKQDVKICLLYLGIYPSGRPIRRGSLLRRWLAEKLITEDPTCSALKVAVDNFNELVNKSIIQPITCANSSNSAEAKTCQTHGMMLEFIRHNTENFVTLLYDNAPLPGNVRWLSLHNEVAVRSNINPNGLPLLRSLTIFGEVRNCMLDFSKYELMRVLDLDECGNQLEDKHLKVICSNLLLLRYLSLRGAAAVTVIPKDIKKLKLLETLDVRGTNIKVLPTQVMKLPCLIHLFGKFIVEDRKMGKLQTWLEKKSKLQTVAGFVVDEKSQGFAQLTEHMHQLTKVKLWCTRSTNKSTDPIATTSSNLSHLSKAIKGFIMRSTQVKEAHSLSLNFNDEWFQGLLVDLSLEKEAPPCYLSSLKLQGDNICSLPPFVTMLRGLTKLCLSSPNQQLQLGEEILAALSKVCGLEYLKIIATQLADLIIGPVTLGSLRRLCIVVEAMTELEIQQGALPRLESLQLLCKNLDGFCHAAEIQSLPRLSEVALHNGVNSGTKQKWKEAAKSHPRRPKLLFVKSTEEVDVESEPATPTTGATLPLKG

Seg: seg
225-240 seg

GVYGRGGGGGGAWESG

superfamily: SSF52540
244-500 P-loop containing nucleoside triphosphate hydrolases

PETETDTTVSAAGLPVPAVGMDMSLDELMELIGETSAQGQQPKELKVISIVGFGGIGKTLLARYAYSNPAVVGQYPARAWVRAAKKGEMDVLNDILRQLGMDPTTVCSGDGSQGSAKLCATINAYLQTKRFFIVIDDMQTEFWGEIKDAFPVVPREDNRVIVTTVNRTIANKCSSPAGHVYLMRTLADKPSRELFFEKACLVCPTPTGDTELGSEVLKKCDGLPLALVSAAQLLHGDPTREQWAHLGENLGRDLATN

Gene3D: G3DSA:3.40.50.300
263-414 no description

GMDMSLDELMELIGETSAQGQQPKELKVISIVGFGGIGKTLLARYAYSNPAVVGQYPARAWVRAAKKGEMDVLNDILRQLGMDPTTVCSGDGSQGSAKLCATINAYLQTKRFFIVIDDMQTEFWGEIKDAFPVVPREDNRVIVTTVNRTIAN

HMMPfam: PF00931
IPR002182
286-555 NB-ARC,NBS
NB-ARC

KELKVISIVGFGGIGKTLLARYAYSNPAVVGQYPARAWVRAAKKGEMDVLNDILRQLGMDPTTVCSGDGSQGSAKLCATINAYLQTKRFFIVIDDMQTEFWGEIKDAFPVVPREDNRVIVTTVNRTIANKCSSPAGHVYLMRTLADKPSRELFFEKACLVCPTPTGDTELGSEVLKKCDGLPLALVSAAQLLHGDPTREQWAHLGENLGRDLATNGNLASMNHALVRSYTSLSKQDVKICLLYLGIYPSGRPIRRGSLLRRWLAEKLITE

FPrintScan: PR00364
IPR000767
290-305 DISEASERSIST
Disease resistance protein

VISIVGFGGIGKTLLA

FPrintScan: PR00364
IPR000767
368-382 DISEASERSIST
Disease resistance protein

YLQTKRFFIVIDDMQ

FPrintScan: PR00364
IPR000767
463-477 DISEASERSIST
Disease resistance protein

CDGLPLALVSAAQLL

superfamily: SSF52047
646-999 RNI-like,LRR

LPLLRSLTIFGEVRNCMLDFSKYELMRVLDLDECGNQLEDKHLKVICSNLLLLRYLSLRGAAAVTVIPKDIKKLKLLETLDVRGTNIKVLPTQVMKLPCLIHLFGKFIVEDRKMGKLQTWLEKKSKLQTVAGFVVDEKSQGFAQLTEHMHQLTKVKLWCTRSTNKSTDPIATTSSNLSHLSKAIKGFIMRSTQVKEAHSLSLNFNDEWFQGLLVDLSLEKEAPPCYLSSLKLQGDNICSLPPFVTMLRGLTKLCLSSPNQQLQLGEEILAALSKVCGLEYLKIIATQLADLIIGPVTLGSLRRLCIVVEAMTELEIQQGALPRLESLQLLCKNLDGFCHAAEIQSLPRLSEVAL

FPrintScan: PR00364
IPR000767
666-682 DISEASERSIST
Disease resistance protein

SKYELMRVLDLDECGNQ

Gene3D: G3DSA:3.80.10.10
669-826 no description

ELMRVLDLDECGNQLEDKHLKVICSNLLLLRYLSLRGAAAVTVIPKDIKKLKLLETLDVRGTNIKVLPTQVMKLPCLIHLFGKFIVEDRKMGKLQTWLEKKSKLQTVAGFVVDEKSQGFAQLTEHMHQLTKVKLWCTRSTNKSTDPIATTSSNLSHLS

Seg: seg
695-704 seg

LLLLRYLSLR

Gene3D: G3DSA:3.80.10.10
837-1001 no description

TQVKEAHSLSLNFNDEWFQGLLVDLSLEKEAPPCYLSSLKLQGDNICSLPPFVTMLRGLTKLCLSSPNQQLQLGEEILAALSKVCGLEYLKIIATQLADLIIGPVTLGSLRRLCIVVEAMTELEIQQGALPRLESLQLLCKNLDGFCHAAEIQSLPRLSEVALHN

Seg: seg
1039-1053 seg

PATPTTGATLPLKGP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox